PRAT4A/TNRC5 Antibody

Images

 
Western Blot: PRAT4A/TNRC5 Antibody [NBP1-91153] - Analysis in human cell line U-937 MG.
Immunohistochemistry-Paraffin: PRAT4A/TNRC5 Antibody [NBP1-91153] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRAT4A/TNRC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSIRAKAAGGRSSSSKQRKEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNPY3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRAT4A/TNRC5 Protein (NBP1-91153PEP)

Reactivity Notes

Mouse (89%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRAT4A/TNRC5 Antibody

  • CAG4A
  • canopy 3 homolog (zebrafish)
  • CNPY3
  • CTG4A
  • ERDA5
  • ERDA5CTG repeat protein 4a
  • Expanded repeat-domain protein CAG/CTG 5
  • PRAT4A
  • PRAT4ACAG repeat containing
  • Protein associated with TLR4
  • protein associated with Toll-like receptor 4A
  • protein canopy homolog 3
  • TNRC5
  • TNRC5expanded repeat domain, CAG/CTG 5
  • trinucleotide repeat containing 5
  • Trinucleotide repeat-containing gene 5 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-24743
Species: Hu, Mu, Rt
Applications: WB
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
NBP1-81085
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for PRAT4A/TNRC5 Antibody (NBP1-91153) (0)

There are no publications for PRAT4A/TNRC5 Antibody (NBP1-91153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAT4A/TNRC5 Antibody (NBP1-91153) (0)

There are no reviews for PRAT4A/TNRC5 Antibody (NBP1-91153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRAT4A/TNRC5 Antibody (NBP1-91153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRAT4A/TNRC5 Products

Bioinformatics Tool for PRAT4A/TNRC5 Antibody (NBP1-91153)

Discover related pathways, diseases and genes to PRAT4A/TNRC5 Antibody (NBP1-91153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAT4A/TNRC5 Antibody (NBP1-91153)

Discover more about diseases related to PRAT4A/TNRC5 Antibody (NBP1-91153).

Blogs on PRAT4A/TNRC5

There are no specific blogs for PRAT4A/TNRC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAT4A/TNRC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNPY3
Entrez