POM121 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: POM121 Antibody [NBP2-13788] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.

Immunohistochemistry-Paraffin: POM121 Antibody [NBP2-13788] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POM121 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POM121
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  POM121 Recombinant Protein Antigen (NBP2-13788PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POM121 Antibody - BSA Free

• FLJ41820
• MGC3792
• nuclear envelope pore membrane protein POM 121
• nuclear pore membrane protein 121 kDa
• nucleoporin Nup121
• NUP121
• P145
• POM121 membrane glycoprotein
• POM121A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POM121