Immunocytochemistry/ Immunofluorescence: NOL1 Antibody [NBP1-92192] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NOL1 Antibody [NBP1-92192] - Staining of human skin shows distinct nucleolar positivity in keratinocytes.
Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in human cell line NTERA-2.
Staining of human kidney shows moderate positivity in nucleoli in cells in tubules.
Staining of human pancreas shows strong positivity in nucleoli in exocrine glandular cells.
Staining of human skin shows strong positivity in nucleoli in squamous epithelial cells.
Staining of human rectum shows strong positivity in nucleoli in glandular cells.
Analysis in human cell line NTERA-2.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Novus Biologicals Rabbit NOL1 Antibody - BSA Free (NBP1-92192) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-NOL1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH
Marker
Nucleolar Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IP, WB reactivity reported in (PMID: 26906424).
Theoretical MW
89 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for NOL1 Antibody - BSA Free
EC 2.1.1
EC 2.1.1.-
MGC149287
MGC149288
NOL1/NOP2/Sun domain family, member 1
NOL1MGC117384
NOP120
NOP2 nucleolar protein homolog (yeast)
NOP2/Sun domain family, member 1
NSUN1
nucleolar protein 1 (120kD)
Nucleolar protein 1
nucleolar protein 1, 120kDa
nucleolar protein 2 homolog (yeast)
Nucleolar protein 2 homolog
p120
Proliferating-cell nucleolar antigen p120
Proliferation-associated nucleolar protein p120
putative ribosomal RNA methyltransferase NOP2
Background
Nucleolar protein 1 (NOL1) is a protein highly expressed in proliferating cells; it is expressed in G1 and peaks during early S phase. It is proposed to play a role in the regulation of the cell cycle, and it may function as a ribosomal RNA methyltransferase. Alternative names for NOL1 include p120 nucleolar-proliferation antigen, nucleolar protein 2 homolog, proliferating-cell nucleolar antigen p120, proliferation-associated nucleolar protein p120, NSUN1, and NOP2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NOL1 Antibody - BSA Free and receive a gift card or discount.