NOL1 Antibody


Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: NOL1 Antibody [NBP1-92192] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NOL1 Antibody [NBP1-92192] - Staining of human skin shows distinct nucleolar positivity in keratinocytes.
Western Blot: NOL1 Antibody [NBP1-92192] - Analysis in human cell line NTERA-2.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP

Order Details

NOL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH
Nucleolar Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IP, WB reactivity reported in (PMID: 26906424).
Theoretical MW
89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
NOL1 Protein (NBP1-92192PEP)
Read Publications using
NBP1-92192 in the following applications:

  • IP
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NOL1 Antibody

  • EC 2.1.1
  • EC 2.1.1.-
  • MGC149287
  • MGC149288
  • NOL1/NOP2/Sun domain family, member 1
  • NOL1MGC117384
  • NOP120
  • NOP2 nucleolar protein homolog (yeast)
  • NOP2/Sun domain family, member 1
  • NSUN1
  • nucleolar protein 1 (120kD)
  • Nucleolar protein 1
  • nucleolar protein 1, 120kDa
  • nucleolar protein 2 homolog (yeast)
  • Nucleolar protein 2 homolog
  • p120
  • Proliferating-cell nucleolar antigen p120
  • Proliferation-associated nucleolar protein p120
  • putative ribosomal RNA methyltransferase NOP2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, ICC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for NOL1 Antibody (NBP1-92192)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NOL1 Antibody (NBP1-92192) (0)

There are no reviews for NOL1 Antibody (NBP1-92192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOL1 Antibody (NBP1-92192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NOL1 Products

Bioinformatics Tool for NOL1 Antibody (NBP1-92192)

Discover related pathways, diseases and genes to NOL1 Antibody (NBP1-92192). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOL1 Antibody (NBP1-92192)

Discover more about diseases related to NOL1 Antibody (NBP1-92192).

Pathways for NOL1 Antibody (NBP1-92192)

View related products by pathway.

PTMs for NOL1 Antibody (NBP1-92192)

Learn more about PTMs related to NOL1 Antibody (NBP1-92192).

Research Areas for NOL1 Antibody (NBP1-92192)

Find related products by research area.

Blogs on NOL1

There are no specific blogs for NOL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NOL1 Antibody and receive a gift card or discount.


Gene Symbol NOP2