IGSF1 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human liver, lymph node, pituitary gland and testis using Anti-IGSF1 antibody NBP2-14119 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human liver.
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human pituitary gland shows strong membranous positivity in cells in anterior lobe.
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human testis.
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP2-14119] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

IGSF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IVMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIAT RPASEQVRAAFPLGALTQSHTGSYHCHSWEEMAVSEPSE
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGSF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGSF1 Recombinant Protein Antigen (NBP2-14119PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGSF1 Antibody

  • CHTE
  • IGCD1
  • IGDC1
  • IGDC1Pituitary gland-specific factor 2
  • IGSF1
  • immunoglobulin superfamily member 1
  • immunoglobulin superfamily, member 1
  • Immunoglobulin-like domain-containing protein 1
  • InhBP
  • Inhibin-binding protein
  • KIAA0364p120
  • MGC75490
  • p120
  • PGSF2
  • PGSF2IGCD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
236-EG
Species: Hu
Applications: BA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1002
Species: Mu
Applications: IHC, Simple Western, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-14119
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for IGSF1 Antibody (NBP2-14119) (0)

There are no publications for IGSF1 Antibody (NBP2-14119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF1 Antibody (NBP2-14119) (0)

There are no reviews for IGSF1 Antibody (NBP2-14119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF1 Antibody (NBP2-14119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF1 Products

Array NBP2-14119

Bioinformatics Tool for IGSF1 Antibody (NBP2-14119)

Discover related pathways, diseases and genes to IGSF1 Antibody (NBP2-14119). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF1 Antibody (NBP2-14119)

Discover more about diseases related to IGSF1 Antibody (NBP2-14119).
 

Pathways for IGSF1 Antibody (NBP2-14119)

View related products by pathway.

PTMs for IGSF1 Antibody (NBP2-14119)

Learn more about PTMs related to IGSF1 Antibody (NBP2-14119).

Blogs on IGSF1

There are no specific blogs for IGSF1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF1