POLR2D Antibody


Immunocytochemistry/ Immunofluorescence: POLR2D Antibody [NBP2-56784] - Staining of human cell line Hep G2 shows localization to nuclear speckles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

POLR2D Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Specificity of human POLR2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POLR2D Recombinant Protein Antigen (NBP2-56784PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for POLR2D Antibody

  • DNA-directed RNA polymerase II 16 kDa polypeptide
  • DNA-directed RNA polymerase II subunit D
  • DNA-directed RNA polymerase II subunit RPB4
  • HSRBP4
  • HSRPB4
  • polymerase (RNA) II (DNA directed) polypeptide D
  • RBP4
  • RNA polymerase II 16 kDa subunit
  • RNA polymerase II subunit B4
  • RNA polymerase II subunit hsRBP4
  • RPB16


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for POLR2D Antibody (NBP2-56784) (0)

There are no publications for POLR2D Antibody (NBP2-56784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2D Antibody (NBP2-56784) (0)

There are no reviews for POLR2D Antibody (NBP2-56784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POLR2D Antibody (NBP2-56784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional POLR2D Products

Bioinformatics Tool for POLR2D Antibody (NBP2-56784)

Discover related pathways, diseases and genes to POLR2D Antibody (NBP2-56784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2D Antibody (NBP2-56784)

Discover more about diseases related to POLR2D Antibody (NBP2-56784).

Pathways for POLR2D Antibody (NBP2-56784)

View related products by pathway.

Research Areas for POLR2D Antibody (NBP2-56784)

Find related products by research area.

Blogs on POLR2D

There are no specific blogs for POLR2D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POLR2D Antibody and receive a gift card or discount.


Gene Symbol POLR2D