POLD3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: POLD3 Antibody [NBP2-38862] - Staining of human cell line U-251 MG shows localization to nucleus.

Immunohistochemistry-Paraffin: POLD3 Antibody [NBP2-38862] - Staining in human testis and skeletal muscle tissues using anti-POLD3 antibody. Corresponding POLD3 RNA-seq data are presented for the same tissues.

Immunohistochemistry: POLD3 Antibody [NBP2-38862] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: POLD3 Antibody [NBP2-38862] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: POLD3 Antibody [NBP2-38862] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLD3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  POLD3 Protein (NBP2-38862PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POLD3 Antibody - BSA Free

• DNA polymerase delta subunit 3
• DNA polymerase delta subunit p66
• DNA polymerase delta, subunit 3
• KIAA0039MGC119643
• MGC119642
• P66
• P68
• polymerase (DNA directed), delta 3
• polymerase (DNA-directed), delta 3, accessory subunit

Background

PolD3/p66 is a subunit of the heterotetrameric DNA polymerase delta that plays a role in DNA replication and repair. The PolD3/p66 subunit has been shown to mediate the interaction between DNA polymerase delta and PCNA (proliferating cell nuclear antigen) to facilitate processivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLD3
• Uniprot:
  • Q15054(Human)