NFkB2/NFkB p100 Antibody

Images

 
Genetic Strategies: Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex, kidney, lymph node and testis using ...read more
Independent Antibodies: Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar pattern to independent antibody ...read more
Immunocytochemistry/ Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human testis.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human kidney.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human lymph node.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex.
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Simple Western lane view shows a specific band for NFKB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under ...read more
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Electropherogram image(s) of corresponding Simple Western lane view. NFkB p100/p52 antibody was used at 1:30 dilution on RT4 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFkB2/NFkB p100 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
NFkB2/NFkB p100 Recombinant Protein Antigen (NBP1-87760PEP)
Publications
Read Publication using NBP1-87760.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFkB2/NFkB p100 Antibody

  • CVID10;H2TF1;LYT10;LYT-10;NF-kB2;Nuclear factor NF-kappa-B p100 subunit;p100;p49/p100;p52
  • LYT10
  • NFkB2
  • NF-kB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NFkB2/NFkB p100 Antibody (NBP1-87760)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for NFkB2/NFkB p100 Antibody (NBP1-87760) (0)

There are no reviews for NFkB2/NFkB p100 Antibody (NBP1-87760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFkB2/NFkB p100 Antibody (NBP1-87760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFkB2/NFkB p100 Products

Research Areas for NFkB2/NFkB p100 Antibody (NBP1-87760)

Find related products by research area.

Blogs on NFkB2/NFkB p100

There are no specific blogs for NFkB2/NFkB p100, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFkB2/NFkB p100 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB2