NFkB2/NFkB p100 Antibody

Images

 
Independent Antibodies: Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar pattern to independent antibody ...read more
Immunocytochemistry/ Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human testis.
Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis in human cell lines A-431 and HeLa using Anti-NFKB2 antibody. Corresponding NFKB2 ...read more
Genetic Strategies: Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 ...read more
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex, kidney, lymph node and testis using ...read more
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human kidney.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human lymph node.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex.
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Simple Western lane view shows a specific band for NFKB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under ...read more
Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Electropherogram image(s) of corresponding Simple Western lane view. NFkB p100/p52 antibody was used at 1:30 dilution on RT4 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFkB2/NFkB p100 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Specificity
Specificity of human NFkB2/NFkB p100 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control
NFkB p100/p52 Knockout HeLa Cell Lysate
NFkB p100/p52 Knockout HeLa Cell Lysate
Control Peptide
NFkB2/NFkB p100 Recombinant Protein Antigen (NBP1-87760PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFkB2/NFkB p100 Antibody

  • LYT10
  • NFkB2
  • NF-kB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-94469
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP, KD
NBP2-15487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20123
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA

Publications for NFkB2/NFkB p100 Antibody (NBP1-87760) (0)

There are no publications for NFkB2/NFkB p100 Antibody (NBP1-87760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFkB2/NFkB p100 Antibody (NBP1-87760) (0)

There are no reviews for NFkB2/NFkB p100 Antibody (NBP1-87760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFkB2/NFkB p100 Antibody (NBP1-87760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NFkB2/NFkB p100 Products

Bioinformatics Tool for NFkB2/NFkB p100 Antibody (NBP1-87760)

Discover related pathways, diseases and genes to NFkB2/NFkB p100 Antibody (NBP1-87760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFkB2/NFkB p100 Antibody (NBP1-87760)

Discover more about diseases related to NFkB2/NFkB p100 Antibody (NBP1-87760).
 

Pathways for NFkB2/NFkB p100 Antibody (NBP1-87760)

View related products by pathway.

PTMs for NFkB2/NFkB p100 Antibody (NBP1-87760)

Learn more about PTMs related to NFkB2/NFkB p100 Antibody (NBP1-87760).

Blogs on NFkB2/NFkB p100

There are no specific blogs for NFkB2/NFkB p100, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFkB2/NFkB p100 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB2