NFkB2/NFkB p100 Antibody

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 antibody. Corresponding NFKB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar protein distribution across tissues to independent antibody NBP1-87759 (B).

Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar pattern to independent antibody NBP1-87759 (B).

Immunocytochemistry/Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human testis.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human appendix shows high expression.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human kidney.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human lymph node.

Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cerebral cortex.

Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Simple Western lane view shows a specific band for NFKB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.

Simple Western: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Electropherogram image(s) of corresponding Simple Western lane view. NFkB p100/p52 antibody was used at 1:30 dilution on RT4 lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NFkB2/NFkB p100 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  NFkB2/NFkB p100 Recombinant Protein Antigen (NBP1-87760PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NFkB2/NFkB p100 Antibody

• CVID10;H2TF1;LYT10;LYT-10;NF-kB2;Nuclear factor NF-kappa-B p100 subunit;p100;p49/p100;p52
• LYT10
• NFkB2
• NF-kB2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFKB2