DDX17 Antibody - BSA Free

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985] - Staining in human epididymis and skeletal muscle tissues using anti-DDX17 antibody. Corresponding DDX17 RNA-seq data are presented for the same tissues.

Western Blot: DDX17 Antibody [NBP2-38985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: DDX17 Antibody [NBP2-38985] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985] - Staining of human epididymis shows high expression.

Immunohistochemistry-Paraffin: DDX17 Antibody [NBP2-38985] - Staining of human skeletal muscle shows low expression as expected.

ChIP-Exo-Seq composite graph for Anti-DDX17 (NBP2-38985) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ChIP, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX17 Antibody - BSA Free (NBP2-38985) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation 1-10µg per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX17 Protein (NBP2-38985PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX17 Antibody - BSA Free

• DDX17
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
• DEAD box protein 17
• DEAD box protein p72
• DEAD/H box 17
• DKFZp761H2016
• EC 3.6.1
• EC 3.6.4.13
• p72
• P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)
• probable ATP-dependent RNA helicase DDX17
• RH70
• RNA-dependent helicase p72

Background

DDX17 (p72) is a highly related member of the DEAD box family and is an established RNA helicase. It has been implicated in growth regulation and has been shown to be involved in both pre-mRNA and pre-rRNA processing. This protein has also been reported to act as a transcriptional co-activator for estrogen-receptor alpha (ER ) and shown to interact with co-activators p300/CBP and the RNA polymerase II holoenzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX17
• Uniprot:
  • Q92841()