Placental Lactogen/CSH1 Antibody

Images

 
Western Blot: Placental Lactogen/CSH1 Antibody [NBP1-59302] - Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta
Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP1-59302] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Placental Lactogen/CSH1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CSH1 (chorionic somatomammotropin hormone 1 (placental lactogen)) The peptide sequence was selected from the middle region of CSH1. Peptide sequence SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSH1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CSH1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Placental Lactogen/CSH1 Antibody

  • Choriomammotropin
  • chorionic somatomammotropin hormone 1 (placental lactogen)
  • chorionic somatomammotropin hormone
  • CS-1
  • CSAchorionic somatomammotropin A
  • CSH1
  • CSH2
  • CSMT
  • FLJ75407
  • hCS-A
  • Lactogen
  • PL
  • Placental Lactogen
  • PLchoriomammotropin

Background

CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59302
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Placental Lactogen/CSH1 Antibody (NBP1-59302) (0)

There are no publications for Placental Lactogen/CSH1 Antibody (NBP1-59302).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Placental Lactogen/CSH1 Antibody (NBP1-59302) (0)

There are no reviews for Placental Lactogen/CSH1 Antibody (NBP1-59302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Placental Lactogen/CSH1 Antibody (NBP1-59302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Placental Lactogen/CSH1 Products

Bioinformatics Tool for Placental Lactogen/CSH1 Antibody (NBP1-59302)

Discover related pathways, diseases and genes to Placental Lactogen/CSH1 Antibody (NBP1-59302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Placental Lactogen/CSH1 Antibody (NBP1-59302)

Discover more about diseases related to Placental Lactogen/CSH1 Antibody (NBP1-59302).
 

Pathways for Placental Lactogen/CSH1 Antibody (NBP1-59302)

View related products by pathway.

PTMs for Placental Lactogen/CSH1 Antibody (NBP1-59302)

Learn more about PTMs related to Placental Lactogen/CSH1 Antibody (NBP1-59302).

Blogs on Placental Lactogen/CSH1

There are no specific blogs for Placental Lactogen/CSH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Placental Lactogen/CSH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSH1
Entrez
Uniprot