PIMT Antibody - BSA Free

Western Blot: PIMT Antibody [NBP1-54942] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PIMT Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TGS1(trimethylguanosine synthase homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TGS1. Peptide sequence IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 96 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PIMT Antibody - BSA Free

• Cap-specific guanine-N2 methyltransferase
• CLL-associated antigen KW-2
• DKFZp762A163
• EC 2.1.1
• EC 2.1.1.-
• HCA137
• Hepatocellular carcinoma-associated antigen 137
• NCOA6IPSEREX-defined
• nuclear receptor coactivator 6 interacting protein
• Nuclear receptor coactivator 6-interacting protein
• PIMTFLJ22995
• PIPMT
• PRIP-interacting protein PIPMT
• PRIP-interacting protein with methyltransferase domain
• PRIP-interacting protein with methyltransferase motif
• trimethylguanosine synthase 1
• trimethylguanosine synthase homolog (S. cerevisiae)
• trimethylguanosine synthase homolog
• trimethylguanosine synthase

Background

TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGS1
• Uniprot:
  • Q96RS0(Human)