PIGU Antibody


Immunohistochemistry: PIGU Antibody [NBP2-30386] - Staining of human kidney shows strong cytoplasmic positivity, seen with a granular pattern, in renal tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PIGU Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINN
Specificity of human PIGU antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGU Protein (NBP2-30386PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PIGU Antibody

  • bA346K17.2
  • CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1
  • CDC91L1CDC91 cell division cycle 91-like 1 (S. cerevisiae)
  • cell division cycle 91-like 1 protein
  • Cell division cycle protein 91-like 1
  • GAB1
  • GPI transamidase component PIG-U
  • GPI transamidase subunit
  • MGC40420
  • phosphatidylinositol glycan anchor biosynthesis class U protein
  • phosphatidylinositol glycan anchor biosynthesis, class U
  • Protein CDC91-like 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, Block, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PIGU Antibody (NBP2-30386) (0)

There are no publications for PIGU Antibody (NBP2-30386).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGU Antibody (NBP2-30386) (0)

There are no reviews for PIGU Antibody (NBP2-30386). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIGU Antibody (NBP2-30386) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PIGU Products

PIGU NBP2-30386

Bioinformatics Tool for PIGU Antibody (NBP2-30386)

Discover related pathways, diseases and genes to PIGU Antibody (NBP2-30386). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGU Antibody (NBP2-30386)

Discover more about diseases related to PIGU Antibody (NBP2-30386).

Pathways for PIGU Antibody (NBP2-30386)

View related products by pathway.

Blogs on PIGU

There are no specific blogs for PIGU, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIGU Antibody and receive a gift card or discount.


Gene Symbol PIGU