Novus Biologicals products are now on bio-techne.com

GAB2 Antibody

Images

 
Immunohistochemistry-Paraffin: GAB2 Antibody [NBP1-81500] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GAB2 Antibody [NBP1-81500] - Analysis in human bone marrow and skeletal muscle tissues. Corresponding GAB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GAB2 Antibody [NBP1-81500] - Staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GAB2 Antibody [NBP1-81500] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: GAB2 Antibody [NBP1-81500] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GAB2 Antibody [NBP1-81500] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GAB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GAB2 Protein (NBP1-81500PEP)
Publications
Read Publication using NBP1-81500.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (85%). Reactivity reported in scientific literature (PMID: 16524965)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAB2 Antibody

  • GAB2
  • GRB2-associated binding protein 2
  • GRB2-associated-binding protein 2
  • Growth factor receptor bound protein 2-associated protein 2
  • KIAA0571GRB2-associated binder 2
  • p100
  • pp100

Background

Gab2 (Grb2-associated binder-2) is an adaptor protein involved in numerous intracellular signaling pathways via its interaction with receptor tyrosine kinases (RTKs), growth factors and cytokines. Gab2 is a substrate of various RTKs, including EGFR, insulin receptor, cytokine receptors as well as B and T cell antigen receptors; Gab2 acts as a docking protein for several SH2-containing proteins (1-3). Upon tyrosine phosphorylation, Gab2 interacts with SHP2 tyrosine phosphatase and GRB2 adaptor protein PI3-kinase, CrkL and SHC (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-37742
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-30386
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
203-IL
Species: Hu
Applications: BA
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-34136
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67058
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6777
Species: Hu
Applications: ICC, WB
NBP1-90078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GAB2 Antibody (NBP1-81500)(1)

Reviews for GAB2 Antibody (NBP1-81500) (0)

There are no reviews for GAB2 Antibody (NBP1-81500). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GAB2 Antibody (NBP1-81500) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAB2 Products

Research Areas for GAB2 Antibody (NBP1-81500)

Find related products by research area.

Blogs on GAB2.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAB2