Phosphoribosyl Pyrophosphate Amidotransferase Antibody

Images

 
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - 1. Human Skin Fibroblasts (100ug) 2. HepG2 cells (20 ug) 3. HEK273 cells (20 ug) 4. HeLa skin cells(20 ug) 5. Hamster CHO K1 cells (20 ...read more
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with ...read more
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - HepG2 Cell Lysate, concentration 0.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phosphoribosyl Pyrophosphate Amidotransferase Antibody Summary

Immunogen
Synthetic peptides corresponding to PPAT(phosphoribosyl pyrophosphate amidotransferase) The peptide sequence was selected from the N terminal of PPAT. Peptide sequence VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PPAT and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Phosphoribosyl Pyrophosphate Amidotransferase Antibody

  • ATASE
  • EC 2.4.2.14
  • glutamine phosphoribosylpyrophosphatate amidotransferase
  • Glutamine phosphoribosylpyrophosphate amidotransferase
  • glutamine PRPP amidotransferase
  • GPATamidophosphoribosyltransferase
  • phosphoribosyl pyrophosphate amidotransferase
  • PRAT

Background

PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
H00008443-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-52964
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964) (0)

There are no publications for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964) (0)

There are no reviews for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phosphoribosyl Pyrophosphate Amidotransferase Products

Bioinformatics Tool for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964)

Discover related pathways, diseases and genes to Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964)

Discover more about diseases related to Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964).
 

Pathways for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964)

View related products by pathway.

PTMs for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964)

Learn more about PTMs related to Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964).
 

Research Areas for Phosphoribosyl Pyrophosphate Amidotransferase Antibody (NBP1-52964)

Find related products by research area.

Blogs on Phosphoribosyl Pyrophosphate Amidotransferase

There are no specific blogs for Phosphoribosyl Pyrophosphate Amidotransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phosphoribosyl Pyrophosphate Amidotransferase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAT
Uniprot