ADE2 Antibody

Images

 
Western Blot: ADE2 Antibody [NBP1-90235] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Independent Antibodies: Western Blot: ADE2 Antibody [NBP1-90235] - Analysis using Anti-PAICS antibody NBP1-90235 (A) shows similar pattern to independent antibody NBP2-58966 (B).
Simple Western: ADE2 Antibody [NBP1-90235] - Simple Western lane view shows a specific band for ADE2 in 0.2 mg/ml of RT-4 and U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: ADE2 Antibody [NBP1-90235] - Electropherogram image(s) of corresponding Simple Western lane view. ADE2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, Rt, ChHaSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

ADE2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS
Specificity
Specificity of ADE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAICS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:20
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Publications
Read Publications using
NBP1-90235 in the following applications:

  • IHC
    1 publication
  • WB
    2 publications

Reactivity Notes

Chinese Hamster reactivity reported in scientific literature (PMID: 23394948).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADE2 Antibody

  • ADE2
  • AIR carboxylase
  • AIRCADE2H1
  • DKFZp781N1372
  • MGC1343
  • MGC5024
  • multifunctional protein ADE2
  • PAIS
  • phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazolesuccinocarboxamide synthetase
  • SAICAR synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00008847-P01
Species: Hu
NBP2-44753
Species: Hu
Applications: Flow, IF
H00002618-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32906
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, Flow-IC
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-93337
Species: Hu, Mu
Applications: WB, IP
AF3848
Species: Hu
Applications: WB, IHC, IP
AF4479
Species: Hu
Applications: IHC
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-41208
Species: Hu
Applications: WB
NBP2-27500
Species: Mu
Applications: WB, PEP-ELISA, KO
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P

Publications for ADE2 Antibody (NBP1-90235)(3)

Reviews for ADE2 Antibody (NBP1-90235) (0)

There are no reviews for ADE2 Antibody (NBP1-90235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADE2 Antibody (NBP1-90235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADE2 Products

Bioinformatics Tool for ADE2 Antibody (NBP1-90235)

Discover related pathways, diseases and genes to ADE2 Antibody (NBP1-90235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADE2 Antibody (NBP1-90235)

Discover more about diseases related to ADE2 Antibody (NBP1-90235).
 

Pathways for ADE2 Antibody (NBP1-90235)

View related products by pathway.

Research Areas for ADE2 Antibody (NBP1-90235)

Find related products by research area.

Blogs on ADE2

There are no specific blogs for ADE2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAICS
Entrez
Uniprot
COVID-19 update