ADE2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Analysis in human liver and skeletal muscle tissues using NBP1-90235 antibody. Corresponding PAICS RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Simple Western: ADE2 Antibody [NBP1-90235] - Electropherogram image(s) of corresponding Simple Western lane view. ADE2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: ADE2 Antibody [NBP1-90235] - Analysis using Anti-PAICS antibody NBP1-90235 (A) shows similar pattern to independent antibody NBP2-58966 (B).

• Reactivity: Hu, Mu, Rt, ChHa
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADE2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ADE2 Antibody - BSA Free (NBP1-90235) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-ADE2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAICS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 47, 50 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ADE2 Protein (NBP1-90235PEP)

Reactivity Notes

Chinese Hamster reactivity reported in scientific literature (PMID: 23394948).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ADE2 Antibody - BSA Free

• ADE2
• AIR carboxylase
• AIRCADE2H1
• DKFZp781N1372
• MGC1343
• MGC5024
• multifunctional protein ADE2
• PAIS
• phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazolesuccinocarboxamide synthetase
• SAICAR synthetase

Background

The ADE2 gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine bio

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ADE2 Antibody (NBP1-90235)(3)

Publications using NBP1-90235

• Barfeld SJ, Fazli L, Persson M et al. Myc-dependent purine biosynthesis affects nucleolar stress and therapy response in prostate cancer. Oncotarget 2015-05-20 [PMID: 25869206] (WB, IF/IHC, Human)
• Zhao A, Tsechansky M, Swaminathan J et al. Transiently Transfected Purine Biosynthetic Enzymes Form Stress Bodies. PLoS One 2013-01-01 [PMID: 23405267]
• Duval N, Luhrs K, Wilkinson TG II et al. Genetic and metabolomic analysis of AdeD and AdeI mutants of de novo purine biosynthesis: cellular models of de novo purine biosynthesis deficiency disorders. Mol Genet Metab 2013-03-01 [PMID: 23394948] (WB, Chinese Hamster)

Bioinformatics

• Gene Symbol: PAICS
• Entrez:
  • 10606(Human)
• Uniprot:
  • P22234(Human)