Phenylalanine Hydroxylase Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human cerebral cortex, kidney, liver and pancreas using Anti-Phenylalanine Hydroxylase antibody ...read more
Independent Antibodies: Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Analysis using Anti-PAH antibody NBP1-80917 (A) shows similar pattern to independent antibody NBP2-48615 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phenylalanine Hydroxylase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phenylalanine Hydroxylase Protein (NBP1-80917PEP)

Reactivity Notes

Mouse (86%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phenylalanine Hydroxylase Antibody

  • EC 1.14.16
  • EC 1.14.16.1
  • PH
  • phe-4-monooxygenase
  • phenylalanine 4-monooxygenase
  • phenylalanine hydroxylase
  • phenylalanine-4-hydroxylase
  • PKU
  • PKU1

Background

PAH encodes the enzyme phenylalanine hydroxylase that is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Phenylalanine Hydroxylase Antibody (NBP1-80917) (0)

There are no publications for Phenylalanine Hydroxylase Antibody (NBP1-80917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phenylalanine Hydroxylase Antibody (NBP1-80917) (0)

There are no reviews for Phenylalanine Hydroxylase Antibody (NBP1-80917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phenylalanine Hydroxylase Antibody (NBP1-80917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phenylalanine Hydroxylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAH
Entrez
Uniprot