Phenylalanine Hydroxylase Antibody

Images

 
Independent Antibodies: Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Analysis using Anti-PAH antibody NBP1-80917 (A) shows similar pattern to independent antibody NBP2-48615 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human cerebral cortex, kidney, liver and pancreas using Anti-Phenylalanine Hydroxylase antibody ...read more
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-80917] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phenylalanine Hydroxylase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phenylalanine Hydroxylase Protein (NBP1-80917PEP)

Reactivity Notes

Mouse (86%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phenylalanine Hydroxylase Antibody

  • EC 1.14.16
  • EC 1.14.16.1
  • PH
  • phe-4-monooxygenase
  • phenylalanine 4-monooxygenase
  • phenylalanine hydroxylase
  • phenylalanine-4-hydroxylase
  • PKU
  • PKU1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2289
Species: Hu, Mu, Rt, Gp
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00009356-M05
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
1106-PI
Species: Hu
NBP2-32408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC, IHC-P, In vitro
NBP2-47501
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Phenylalanine Hydroxylase Antibody (NBP1-80917) (0)

There are no publications for Phenylalanine Hydroxylase Antibody (NBP1-80917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phenylalanine Hydroxylase Antibody (NBP1-80917) (0)

There are no reviews for Phenylalanine Hydroxylase Antibody (NBP1-80917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phenylalanine Hydroxylase Antibody (NBP1-80917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Phenylalanine Hydroxylase Products

Bioinformatics Tool for Phenylalanine Hydroxylase Antibody (NBP1-80917)

Discover related pathways, diseases and genes to Phenylalanine Hydroxylase Antibody (NBP1-80917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phenylalanine Hydroxylase Antibody (NBP1-80917)

Discover more about diseases related to Phenylalanine Hydroxylase Antibody (NBP1-80917).
 

Pathways for Phenylalanine Hydroxylase Antibody (NBP1-80917)

View related products by pathway.

PTMs for Phenylalanine Hydroxylase Antibody (NBP1-80917)

Learn more about PTMs related to Phenylalanine Hydroxylase Antibody (NBP1-80917).

Blogs on Phenylalanine Hydroxylase

There are no specific blogs for Phenylalanine Hydroxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phenylalanine Hydroxylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAH
Entrez
Uniprot