PGRMC2 Antibody


Western Blot: PGRMC2 Antibody [NBP2-13753] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: PGRMC2 Antibody [NBP2-13753] - Staining of human cell line HeLa shows localization to nuclear bodies, nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: PGRMC2 Antibody [NBP2-13753] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/ Immunofluorescence: PGRMC2 Antibody [NBP2-13753] - Staining of human cell line HeLa shows positivity in nuclear membrane and cytoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PGRMC2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PGRMC2 Protein (NBP2-13753PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PGRMC2 Antibody

  • DG6progesterone membrane binding protein
  • membrane-associated progesterone receptor component 2
  • PMBPProgesterone membrane-binding protein
  • progesterone receptor membrane component 2
  • Steroid receptor protein DG6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PGRMC2 Antibody (NBP2-13753) (0)

There are no publications for PGRMC2 Antibody (NBP2-13753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGRMC2 Antibody (NBP2-13753) (0)

There are no reviews for PGRMC2 Antibody (NBP2-13753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGRMC2 Antibody (NBP2-13753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PGRMC2 Products

Bioinformatics Tool for PGRMC2 Antibody (NBP2-13753)

Discover related pathways, diseases and genes to PGRMC2 Antibody (NBP2-13753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGRMC2 Antibody (NBP2-13753)

Discover more about diseases related to PGRMC2 Antibody (NBP2-13753).

Pathways for PGRMC2 Antibody (NBP2-13753)

View related products by pathway.

Blogs on PGRMC2

There are no specific blogs for PGRMC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGRMC2 Antibody and receive a gift card or discount.


Gene Symbol PGRMC2