Genetic Strategies: Western Blot: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 accelerates tumor growth through the EGFR signaling pathway. Nucleotide sequences of PGRMC1 targeted by shRNA ...read more
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing ...read more
Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).
Genetic Strategies: Western Blot: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 is necessary for tumor proliferation mediated by EGFR signaling. HCT116 cells expressing control shRNA or ...read more
Analysis in human liver and skeletal muscle tissues using NBP1-83220 antibody. Corresponding PGRMC1 RNA-seq data are presented for the same tissues.
Analysis in human liver tissue.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Novus Biologicals Rabbit PGRMC1 Antibody - BSA Free (NBP1-83220) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-PGRMC1 Antibody: Cited in 15 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGRMC1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/ Immunofluorescence Reported in literature (PMID:23242527).
Immunohistochemistry 1:500 - 1:1000
Immunohistochemistry-Paraffin 1:500-1:1000
Knockdown Validated
Simple Western 1:20
Western Blot 0.04-0.4 ug/ml
Application Notes
IHC-Paraffin HIER pH6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 35 kDa
Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PGRMC1 Antibody - BSA Free and receive a gift card or discount.