PGRMC1 Antibody


Western Blot: PGRMC1 Antibody [NBP1-83220] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissue
Immunocytochemistry/ Immunofluorescence: PGRMC1 Antibody [NBP1-83220] - Staining of human cell line U-251 MG shows positivity in nucleoli & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.
Western Blot: PGRMC1 Antibody [NBP1-83220] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing more
Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

PGRMC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
PGRMC1 Protein (NBP1-83220PEP)
Read Publications using
NBP1-83220 in the following applications:

  • 2 publications
  • IHC
    2 publications
  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22147012)

Alternate Names for PGRMC1 Antibody

  • HPR6.6
  • membrane-associated progesterone receptor component 1
  • MPR
  • Progesterone Binding Protein
  • progesterone receptor membrane component 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, PA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP
Species: Hu, Mu
Applications: WB, Simple Western
Species: Mu
Applications: WB, IHC, IP

Publications for PGRMC1 Antibody (NBP1-83220)(11)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using NBP1-83220 Applications Species
He H, Cattran AW, Nguyen T et al. Triple-responsive Expansile Nanogel for Tumor and Mitochondria Targeted Photosensitizer Delivery. Biomaterials 2014 Nov [PMID:25154666] (IHC, Human) IHC Human
.Allen TK, Feng L, Grotegut CA, Murtha AP Progesterone Receptor Membrane Component 1 as the Mediator of the Inhibitory Effect of Progestins on Cytokine-Induced Matrix Metalloproteinase 9 Activity In Vitro. Reprod Sci 2014 Feb [PMID:23813454] (IHC, Human) IHC Human
Bali N, Arimoto JM, Morgan TE et al. Progesterone Antagonism of Neurite Outgrowth Depends on Microglial Activation via Pgrmc1/S2R. Endocrinology 2013 Jul [PMID:23653459] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Hulce JJ, Cognetta AB, Niphakis MJ et al. Proteome-wide mapping of cholesterol-interacting proteins in mammalian cells. Nat Methods 2013 Mar [PMID:23396283]
Peluso JJ, Yuan A, Liu X, Lodde V. Plasminogen Activator Inhibitor 1 RNA-Binding Protein Interacts with Progesterone Receptor Membrane Component 1 to Regulate Progesterones Ability to Maintain the Viability of Spontaneously Immortalized Granulosa Cells and Rat Granulosa Cells. Biol Reprod 2013 Jan [PMID:23242527] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Peluso JJ, Lodde V, Liu X. Progesterone Regulation of Progesterone Receptor Membrane Component 1 (PGRMC1) Sumoylation and Transcriptional Activity in Spontaneously Immortalized Granulosa Cells. Endocrinology 2012 Aug [PMID:22719051]
Peluso JJ, DeCerbo J, Lodde V. Evidence for a genomic mechanism of action for Progesterone Receptor Membrane Component-1. Steroids 2012 Aug [PMID:22326699]
Bali N, Arimoto JM, Iwata N et al. Differential Responses of Progesterone Receptor Membrane Component-1 (Pgrmc1) and the Classical Progesterone Receptor (Pgr) to 17-beta-Estradiol and Progesterone in Hippocampal Subregions that Support Synaptic Remodeling and Neurogenesis. Endocrinology 2012 Feb [PMID:22147012]
Luciano AM, Corbani D, Lodde V et al. Expression of progesterone receptor membrane component-1 in bovine reproductive system during estrous cycle. Eur J Histochem 2011 [PMID:22073374]
Peluso JJ, Liu X, Gawkowska A et al. Progesterone inhibits apoptosis in part by PGRMC1-regulated gene expression. Mol Cell Endocrinol 2010 May [PMID:20144686]
Show All 11 Publications.

Reviews for PGRMC1 Antibody (NBP1-83220) (0)

There are no reviews for PGRMC1 Antibody (NBP1-83220). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGRMC1 Antibody (NBP1-83220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PGRMC1 Antibody Products

Related Products by Gene

Bioinformatics Tool for PGRMC1 Antibody (NBP1-83220)

Discover related pathways, diseases and genes to PGRMC1 Antibody (NBP1-83220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGRMC1 Antibody (NBP1-83220)

Discover more about diseases related to PGRMC1 Antibody (NBP1-83220).

Pathways for PGRMC1 Antibody (NBP1-83220)

View related products by pathway.

PTMs for PGRMC1 Antibody (NBP1-83220)

Learn more about PTMs related to PGRMC1 Antibody (NBP1-83220).

Research Areas for PGRMC1 Antibody (NBP1-83220)

Find related products by research area.

Blogs on PGRMC1

There are no specific blogs for PGRMC1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol PGRMC1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83220 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought