PGRMC1 Antibody


Western Blot: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 accelerates tumor growth through the EGFR signaling pathway. Nucleotide sequences of PGRMC1 targeted by shRNA and of the shRNA-resistant more
Orthogonal Strategies: Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining in human liver and skeletal muscle tissues . Corresponding PGRMC1 RNA-seq data are presented for the same tissues.
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing more
Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).
Genetic Strategies: Knockdown Validated: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 is necessary for tumor proliferation mediated by EGFR signaling. HCT116 cells expressing control shRNA more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Order Details

PGRMC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB, ICC/IF reported in literature (PMID:23242527). IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
PGRMC1 Protein (NBP1-83220PEP)
Read Publications using
NBP1-83220 in the following applications:

  • 2 publications
  • IHC
    2 publications
  • WB
    5 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22147012)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PGRMC1 Antibody

  • HPR6.6
  • membrane-associated progesterone receptor component 1
  • MPR
  • PGRMC1
  • Progesterone Binding Protein
  • progesterone receptor membrane component 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: Flow, IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ICC, IHC, IP, WB

Publications for PGRMC1 Antibody (NBP1-83220)(14)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using NBP1-83220 Applications Species
Jalloh A, Flowers A, Hudson C et al. Polyphenol Supplementation Reverses Age-Related Changes in Microglial Signaling Cascades International Journal of Molecular Sciences Jun 14 2021 [PMID: 34198710] (WB, Rat) WB Rat
Dubey, N, Hoffman, J F Et al. The ESC/E(Z) complex, an effector of response to ovarian steroids, manifests an intrinsic difference in cells from women with premenstrual dysphoric disorder. Mol Psychiatry Aug 1 2017 [PMID: 28044059] (WB, Mouse) WB Mouse
Kabe Y, Nakane T, Koike I et al. Haem-dependent dimerization of PGRMC1/Sigma-2 receptor facilitates cancer proliferation and chemoresistance. Nat Commun 2016 Mar 18 [PMID: 26988023] (WB) WB
He H, Cattran AW, Nguyen T et al. Triple-responsive Expansile Nanogel for Tumor and Mitochondria Targeted Photosensitizer Delivery. Biomaterials 2014 Nov [PMID: 25154666] (IHC, Human) IHC Human
.Allen TK, Feng L, Grotegut CA, Murtha AP Progesterone Receptor Membrane Component 1 as the Mediator of the Inhibitory Effect of Progestins on Cytokine-Induced Matrix Metalloproteinase 9 Activity In Vitro. Reprod Sci 2014 Feb [PMID: 23813454] (IHC, Human) IHC Human
Bali N, Arimoto JM, Morgan TE et al. Progesterone Antagonism of Neurite Outgrowth Depends on Microglial Activation via Pgrmc1/S2R. Endocrinology 2013 Jul [PMID: 23653459] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Hulce JJ, Cognetta AB, Niphakis MJ et al. Proteome-wide mapping of cholesterol-interacting proteins in mammalian cells. Nat Methods 2013 Mar [PMID: 23396283]
Peluso JJ, Yuan A, Liu X, Lodde V. Plasminogen Activator Inhibitor 1 RNA-Binding Protein Interacts with Progesterone Receptor Membrane Component 1 to Regulate Progesterones Ability to Maintain the Viability of Spontaneously Immortalized Granulosa Cells and Rat Granulosa Cells. Biol Reprod 2013 Jan [PMID: 23242527] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Peluso JJ, Lodde V, Liu X. Progesterone Regulation of Progesterone Receptor Membrane Component 1 (PGRMC1) Sumoylation and Transcriptional Activity in Spontaneously Immortalized Granulosa Cells. Endocrinology 2012 Aug [PMID: 22719051]
Peluso JJ, DeCerbo J, Lodde V. Evidence for a genomic mechanism of action for Progesterone Receptor Membrane Component-1. Steroids 2012 Aug [PMID: 22326699]
Show All 14 Publications.

Reviews for PGRMC1 Antibody (NBP1-83220) (0)

There are no reviews for PGRMC1 Antibody (NBP1-83220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGRMC1 Antibody (NBP1-83220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PGRMC1 Products

Bioinformatics Tool for PGRMC1 Antibody (NBP1-83220)

Discover related pathways, diseases and genes to PGRMC1 Antibody (NBP1-83220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGRMC1 Antibody (NBP1-83220)

Discover more about diseases related to PGRMC1 Antibody (NBP1-83220).

Pathways for PGRMC1 Antibody (NBP1-83220)

View related products by pathway.

PTMs for PGRMC1 Antibody (NBP1-83220)

Learn more about PTMs related to PGRMC1 Antibody (NBP1-83220).

Research Areas for PGRMC1 Antibody (NBP1-83220)

Find related products by research area.

Blogs on PGRMC1

There are no specific blogs for PGRMC1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGRMC1 Antibody and receive a gift card or discount.


Gene Symbol PGRMC1