PGRMC1 Antibody

Images

 
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PGRMC1 Antibody [NBP1-83220] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & endoplasmic reticulum.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing ...read more
Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGRMC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGRMC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
PGRMC1 Protein (NBP1-83220PEP)
Publications
Read Publications using
NBP1-83220 in the following applications:

  • 2 publications
  • IHC
    2 publications
  • WB
    3 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22147012)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGRMC1 Antibody

  • HPR6.6
  • HPR6.6PGRMC
  • membrane-associated progesterone receptor component 1
  • MPR
  • PGRMC1
  • Progesterone Binding Protein
  • progesterone receptor membrane component 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
H00010424-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-85660
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5320
Species: Hu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for PGRMC1 Antibody (NBP1-83220)(12)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(2)
IHC
(2)
WB
(3)
All Applications
Filter By Species
Human
(2)
Rat
(2)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using NBP1-83220 Applications Species
Kabe Y, Nakane T, Koike I et al. Haem-dependent dimerization of PGRMC1/Sigma-2 receptor facilitates cancer proliferation and chemoresistance. Nat Commun 2016 Mar 18 [PMID: 26988023] (WB) WB
He H, Cattran AW, Nguyen T et al. Triple-responsive Expansile Nanogel for Tumor and Mitochondria Targeted Photosensitizer Delivery. Biomaterials 2014 Nov [PMID: 25154666] (IHC, Human) IHC Human
.Allen TK, Feng L, Grotegut CA, Murtha AP Progesterone Receptor Membrane Component 1 as the Mediator of the Inhibitory Effect of Progestins on Cytokine-Induced Matrix Metalloproteinase 9 Activity In Vitro. Reprod Sci 2014 Feb [PMID: 23813454] (IHC, Human) IHC Human
Bali N, Arimoto JM, Morgan TE et al. Progesterone Antagonism of Neurite Outgrowth Depends on Microglial Activation via Pgrmc1/S2R. Endocrinology 2013 Jul [PMID: 23653459] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Hulce JJ, Cognetta AB, Niphakis MJ et al. Proteome-wide mapping of cholesterol-interacting proteins in mammalian cells. Nat Methods 2013 Mar [PMID: 23396283]
Peluso JJ, Yuan A, Liu X, Lodde V. Plasminogen Activator Inhibitor 1 RNA-Binding Protein Interacts with Progesterone Receptor Membrane Component 1 to Regulate Progesterones Ability to Maintain the Viability of Spontaneously Immortalized Granulosa Cells and Rat Granulosa Cells. Biol Reprod 2013 Jan [PMID: 23242527] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Peluso JJ, Lodde V, Liu X. Progesterone Regulation of Progesterone Receptor Membrane Component 1 (PGRMC1) Sumoylation and Transcriptional Activity in Spontaneously Immortalized Granulosa Cells. Endocrinology 2012 Aug [PMID: 22719051]
Peluso JJ, DeCerbo J, Lodde V. Evidence for a genomic mechanism of action for Progesterone Receptor Membrane Component-1. Steroids 2012 Aug [PMID: 22326699]
Bali N, Arimoto JM, Iwata N et al. Differential Responses of Progesterone Receptor Membrane Component-1 (Pgrmc1) and the Classical Progesterone Receptor (Pgr) to 17-beta-Estradiol and Progesterone in Hippocampal Subregions that Support Synaptic Remodeling and Neurogenesis. Endocrinology 2012 Feb [PMID: 22147012]
Luciano AM, Corbani D, Lodde V et al. Expression of progesterone receptor membrane component-1 in bovine reproductive system during estrous cycle. Eur J Histochem 2011 [PMID: 22073374]
Show All 12 Publications.

Reviews for PGRMC1 Antibody (NBP1-83220) (0)

There are no reviews for PGRMC1 Antibody (NBP1-83220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGRMC1 Antibody (NBP1-83220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGRMC1 Products

Bioinformatics Tool for PGRMC1 Antibody (NBP1-83220)

Discover related pathways, diseases and genes to PGRMC1 Antibody (NBP1-83220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGRMC1 Antibody (NBP1-83220)

Discover more about diseases related to PGRMC1 Antibody (NBP1-83220).
 

Pathways for PGRMC1 Antibody (NBP1-83220)

View related products by pathway.

PTMs for PGRMC1 Antibody (NBP1-83220)

Learn more about PTMs related to PGRMC1 Antibody (NBP1-83220).
 

Research Areas for PGRMC1 Antibody (NBP1-83220)

Find related products by research area.

Blogs on PGRMC1

There are no specific blogs for PGRMC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGRMC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGRMC1
Entrez