PGRMC1 Antibody

Western Blot: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 accelerates tumor growth through the EGFR signaling pathway. Nucleotide sequences of PGRMC1 targeted by shRNA and of the shRNA-resistant full length PGRMC1 expression vector. Stable PGRMC1-knockdown (PGRMC1-KD) HCT116 cells were transiently transfected with the shRNA-resistant expression vector of wild-type PGRMC1 (wt) or the Y113F mutant (Y113F). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms11030), licensed under a CC-BY licence.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining in human liver and skeletal muscle tissues . Corresponding PGRMC1 RNA-seq data are presented for the same tissues.

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human liver tissue.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).

Knockdown Validated: PGRMC1 Antibody [NBP1-83220] - Haem-dependent dimerization of PGRMC1 is necessary for tumor proliferation mediated by EGFR signaling. HCT116 cells expressing control shRNA or those knocking down PGRMC1 (PGRMC1-KD) were treated with EGF or left untreated, and components of the EGFR signaling pathway were detected by Western blotting. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms11030), licensed under a CC-BY licence.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PGRMC1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PGRMC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB, ICC/IF reported in literature (PMID:23242527). IHC-Paraffin HIER pH6 retrieval is recommended.
• Control Peptide:

  PGRMC1 Protein (NBP1-83220PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22147012)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PGRMC1 Antibody

• HPR6.6
• HPR6.6PGRMC
• membrane-associated progesterone receptor component 1
• MPR
• PGRMC1
• Progesterone Binding Protein
• progesterone receptor membrane component 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PGRMC1 Antibody (NBP1-83220)(14)

Publications using NBP1-83220

• Jalloh A, Flowers A, Hudson C et al. Polyphenol Supplementation Reverses Age-Related Changes in Microglial Signaling Cascades International Journal of Molecular Sciences Jun 14 2021 [PMID: 34198710] (WB, Rat)
• Dubey, N, Hoffman, J F Et al. The ESC/E(Z) complex, an effector of response to ovarian steroids, manifests an intrinsic difference in cells from women with premenstrual dysphoric disorder. Mol Psychiatry Aug 1 2017 [PMID: 28044059] (WB, Mouse)
• Kabe Y, Nakane T, Koike I et al. Haem-dependent dimerization of PGRMC1/Sigma-2 receptor facilitates cancer proliferation and chemoresistance. Nat Commun 2016 Mar 18 [PMID: 26988023] (WB)
• He H, Cattran AW, Nguyen T et al. Triple-responsive Expansile Nanogel for Tumor and Mitochondria Targeted Photosensitizer Delivery. Biomaterials 2014 Nov [PMID: 25154666] (IHC, Human)
• .Allen TK, Feng L, Grotegut CA, Murtha AP Progesterone Receptor Membrane Component 1 as the Mediator of the Inhibitory Effect of Progestins on Cytokine-Induced Matrix Metalloproteinase 9 Activity In Vitro. Reprod Sci 2014 Feb [PMID: 23813454] (IHC, Human)
• Bali N, Arimoto JM, Morgan TE et al. Progesterone Antagonism of Neurite Outgrowth Depends on Microglial Activation via Pgrmc1/S2R. Endocrinology 2013 Jul [PMID: 23653459] (WB, ICC/IF, Rat)
• Hulce JJ, Cognetta AB, Niphakis MJ et al. Proteome-wide mapping of cholesterol-interacting proteins in mammalian cells. Nat Methods 2013 Mar [PMID: 23396283]
• Peluso JJ, Yuan A, Liu X, Lodde V. Plasminogen Activator Inhibitor 1 RNA-Binding Protein Interacts with Progesterone Receptor Membrane Component 1 to Regulate Progesterones Ability to Maintain the Viability of Spontaneously Immortalized Granulosa Cells and Rat Granulosa Cells. Biol Reprod 2013 Jan [PMID: 23242527] (WB, ICC/IF, Rat)
• Peluso JJ, Lodde V, Liu X. Progesterone Regulation of Progesterone Receptor Membrane Component 1 (PGRMC1) Sumoylation and Transcriptional Activity in Spontaneously Immortalized Granulosa Cells. Endocrinology 2012 Aug [PMID: 22719051]
• Peluso JJ, DeCerbo J, Lodde V. Evidence for a genomic mechanism of action for Progesterone Receptor Membrane Component-1. Steroids 2012 Aug [PMID: 22326699]
• Bali N, Arimoto JM, Iwata N et al. Differential Responses of Progesterone Receptor Membrane Component-1 (Pgrmc1) and the Classical Progesterone Receptor (Pgr) to 17-beta-Estradiol and Progesterone in Hippocampal Subregions that Support Synaptic Remodeling and Neurogenesis. Endocrinology 2012 Feb [PMID: 22147012]
• Luciano AM, Corbani D, Lodde V et al. Expression of progesterone receptor membrane component-1 in bovine reproductive system during estrous cycle. Eur J Histochem 2011 [PMID: 22073374]
• Peluso JJ, Liu X, Gawkowska A et al. Progesterone inhibits apoptosis in part by PGRMC1-regulated gene expression. Mol Cell Endocrinol 2010 May [PMID: 20144686]
• Glaser S, DeMorrow S, Francis H et al. Progesterone stimulates the proliferation of female and male cholangiocytes via autocrine/paracrine mechanisms. Am J Physiol Gastrointest Liver Physiol 2008 Jul [PMID: 18511743]

Bioinformatics

• Gene Symbol: PGRMC1