ACOX1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ACOX1 Antibody [NBP1-80950] - Staining of human cell line U-2 OS shows positivity in nucleoli & vesicles.
Immunohistochemistry: ACOX1 Antibody [NBP1-80950] - Staining of human stomach shows strong positivity in superficial glandular cells.

Product Details

Summary
Reactivity Hu, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

ACOX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACOX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
ACOX1 Protein (NBP1-80950PEP)
Publications
Read Publication using NBP1-80950.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Reactivity reported in scientific literature (PMID: 23435261)

Alternate Names for ACOX1 Antibody

  • ACOXEC 1.3.3.6
  • acyl-CoA oxidase 1, palmitoyl
  • acyl-CoA oxidase, straight-chain
  • acyl-Coenzyme A oxidase 1, palmitoyl
  • AOX
  • PALMCOX
  • Palmitoyl-CoA oxidase
  • peroxisomal acyl-coenzyme A oxidase 1
  • peroxisomal fatty acyl-CoA oxidase
  • SCOXMGC1198
  • Straight-chain acyl-CoA oxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85479
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88364
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85901
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-80950
Species: Hu, Rat
Applications: ICC/IF, IHC, IHC-P

Publications for ACOX1 Antibody (NBP1-80950)(1)

Reviews for ACOX1 Antibody (NBP1-80950) (0)

There are no reviews for ACOX1 Antibody (NBP1-80950). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACOX1 Antibody (NBP1-80950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACOX1 Antibody Products

Related Products by Gene

Bioinformatics Tool for ACOX1 Antibody (NBP1-80950)

Discover related pathways, diseases and genes to ACOX1 Antibody (NBP1-80950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOX1 Antibody (NBP1-80950)

Discover more about diseases related to ACOX1 Antibody (NBP1-80950).
 

Pathways for ACOX1 Antibody (NBP1-80950)

View related products by pathway.

PTMs for ACOX1 Antibody (NBP1-80950)

Learn more about PTMs related to ACOX1 Antibody (NBP1-80950).
 

Research Areas for ACOX1 Antibody (NBP1-80950)

Find related products by research area.

Blogs on ACOX1

There are no specific blogs for ACOX1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ACOX1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-80950 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought