PGLYRP2/PGRP-L Antibody

Images

 
Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGLYRP2/PGRP-L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGLYRP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGLYRP2/PGRP-L Protein (NBP2-31930PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGLYRP2/PGRP-L Antibody

  • EC 3.5.1.28
  • peptidoglycan recognition protein 2tagl-beta
  • peptidoglycan recognition protein L
  • PGLYRP2
  • PGLYRPL
  • PGLYRPLHMFT0141
  • PGRP2
  • PGRPL
  • PGRP-L
  • PGRP-LN-acetylmuramoyl-L-alanine amidase
  • PGRPLPeptidoglycan recognition protein long
  • TAGL
  • tagL-alpha
  • TAGL-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-47549
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56729
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PGLYRP2/PGRP-L Antibody (NBP2-31930) (0)

There are no publications for PGLYRP2/PGRP-L Antibody (NBP2-31930).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGLYRP2/PGRP-L Antibody (NBP2-31930) (0)

There are no reviews for PGLYRP2/PGRP-L Antibody (NBP2-31930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGLYRP2/PGRP-L Antibody (NBP2-31930). (Showing 1 - 1 of 1 FAQ).

  1. What is the isotype for this antibody?
    • NBP2-31930 is a rabbit polyclonal of the isotype IgG.

Secondary Antibodies

 

Isotype Controls

Additional PGLYRP2/PGRP-L Products

Bioinformatics Tool for PGLYRP2/PGRP-L Antibody (NBP2-31930)

Discover related pathways, diseases and genes to PGLYRP2/PGRP-L Antibody (NBP2-31930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGLYRP2/PGRP-L Antibody (NBP2-31930)

Discover more about diseases related to PGLYRP2/PGRP-L Antibody (NBP2-31930).
 

Pathways for PGLYRP2/PGRP-L Antibody (NBP2-31930)

View related products by pathway.

PTMs for PGLYRP2/PGRP-L Antibody (NBP2-31930)

Learn more about PTMs related to PGLYRP2/PGRP-L Antibody (NBP2-31930).

Blogs on PGLYRP2/PGRP-L

There are no specific blogs for PGLYRP2/PGRP-L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGLYRP2/PGRP-L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGLYRP2
Entrez
Uniprot