
Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
Immunohistochemistry: PGLYRP2/PGRP-L Antibody [NBP2-31930] - Staining of human liver shows distinct cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PGLYRP2/PGRP-L Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP
Specificity of human PGLYRP2/PGRP-L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGLYRP2/PGRP-L Protein (NBP2-31930PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PGLYRP2/PGRP-L Antibody

  • EC
  • peptidoglycan recognition protein 2tagl-beta
  • peptidoglycan recognition protein L
  • PGRP2
  • PGRP-L
  • PGRP-LN-acetylmuramoyl-L-alanine amidase
  • PGRPLPeptidoglycan recognition protein long
  • TAGL
  • tagL-alpha
  • TAGL-like


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for PGLYRP2/PGRP-L Antibody (NBP2-31930) (0)

There are no publications for PGLYRP2/PGRP-L Antibody (NBP2-31930).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGLYRP2/PGRP-L Antibody (NBP2-31930) (0)

There are no reviews for PGLYRP2/PGRP-L Antibody (NBP2-31930). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGLYRP2/PGRP-L Antibody (NBP2-31930). (Showing 1 - 1 of 1 FAQ).

  1. What is the isotype for this antibody?
    • NBP2-31930 is a rabbit polyclonal of the isotype IgG.

Secondary Antibodies


Isotype Controls

Additional PGLYRP2/PGRP-L Products

Bioinformatics Tool for PGLYRP2/PGRP-L Antibody (NBP2-31930)

Discover related pathways, diseases and genes to PGLYRP2/PGRP-L Antibody (NBP2-31930). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGLYRP2/PGRP-L Antibody (NBP2-31930)

Discover more about diseases related to PGLYRP2/PGRP-L Antibody (NBP2-31930).

Pathways for PGLYRP2/PGRP-L Antibody (NBP2-31930)

View related products by pathway.

PTMs for PGLYRP2/PGRP-L Antibody (NBP2-31930)

Learn more about PTMs related to PGLYRP2/PGRP-L Antibody (NBP2-31930).


There are no specific blogs for PGLYRP2/PGRP-L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGLYRP2/PGRP-L Antibody and receive a gift card or discount.


Gene Symbol PGLYRP2