GLTSCR2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GLTSCR2 Antibody [NBP1-80905] - Staining of human cell line U-2 OS shows positivity in nucleoli and vesicles. Antibody staining shown in green.
Immunohistochemistry-Paraffin: GLTSCR2 Antibody [NBP1-80905] - Staining of human hippocampus shows strong nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLTSCR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: REAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Specificity
Specificity of human GLTSCR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLTSCR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLTSCR2 Protein (NBP1-80905PEP)
Publications
Read Publications using
NBP1-80905 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25594032).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLTSCR2 Antibody

  • glioma tumor suppressor candidate region gene 2 protein
  • glioma tumor suppressor candidate region gene 2
  • p60
  • PICT1
  • PICT-1
  • protein interacting with carboxyl terminus 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF269
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81404
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80905
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GLTSCR2 Antibody (NBP1-80905)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GLTSCR2 Antibody (NBP1-80905) (0)

There are no reviews for GLTSCR2 Antibody (NBP1-80905). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLTSCR2 Antibody (NBP1-80905) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GLTSCR2 Antibody (NBP1-80905)

Discover related pathways, diseases and genes to GLTSCR2 Antibody (NBP1-80905). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLTSCR2 Antibody (NBP1-80905)

Discover more about diseases related to GLTSCR2 Antibody (NBP1-80905).
 

Pathways for GLTSCR2 Antibody (NBP1-80905)

View related products by pathway.

PTMs for GLTSCR2 Antibody (NBP1-80905)

Learn more about PTMs related to GLTSCR2 Antibody (NBP1-80905).
 

Research Areas for GLTSCR2 Antibody (NBP1-80905)

Find related products by research area.

Blogs on GLTSCR2

There are no specific blogs for GLTSCR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLTSCR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLTSCR2