AMPD2 Antibody

Images

 
Genetic Strategies: Western Blot: AMPD2 Antibody [NBP2-47549] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: AMPD2 Antibody [NBP2-47549] - Staining of human cell line MCF7 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of mouse olfactory bulb shows strong positivity in neurons and their processes.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of mouse brain shows immunoreactivity in the subcommissural organ.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of mouse medulla shows immunoreactivity in neurons of the paragigantocellular nucleus.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of human hippocampus shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: AMPD2 Antibody [NBP2-47549] - Staining of human cerebral cortex shows nuclear immunoreactivity in glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

AMPD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MDGKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGE
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMPD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMPD2 Protein (NBP2-47549PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMPD2 Antibody

  • adenosine monophosphate deaminase 2 (isoform L)
  • adenosine monophosphate deaminase 2
  • AMP deaminase 2
  • AMP deaminase isoform L
  • AMPD
  • EC 3.5.4.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-49690
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82541
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1905
Species: Mu
Applications: WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-16380
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
210-TA/CF
Species: Hu
Applications: BA
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for AMPD2 Antibody (NBP2-47549) (0)

There are no publications for AMPD2 Antibody (NBP2-47549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPD2 Antibody (NBP2-47549) (0)

There are no reviews for AMPD2 Antibody (NBP2-47549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMPD2 Antibody (NBP2-47549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPD2 Products

Bioinformatics Tool for AMPD2 Antibody (NBP2-47549)

Discover related pathways, diseases and genes to AMPD2 Antibody (NBP2-47549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPD2 Antibody (NBP2-47549)

Discover more about diseases related to AMPD2 Antibody (NBP2-47549).
 

Pathways for AMPD2 Antibody (NBP2-47549)

View related products by pathway.

PTMs for AMPD2 Antibody (NBP2-47549)

Learn more about PTMs related to AMPD2 Antibody (NBP2-47549).

Blogs on AMPD2

There are no specific blogs for AMPD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMPD2