PGCP Antibody - BSA Free

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87457] - Staining in human thyroid gland and cerebral cortex tissues using anti-CPQ antibody. Corresponding CPQ RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: PGCP Antibody [NBP1-87457] - Staining of human cell line ASC TERT1 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87457] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: PGCP Antibody [NBP1-87457] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PGCP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE
• Predicted Species: Mouse (94%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPQ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PGCP Protein (NBP1-87457PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PGCP Antibody - BSA Free

• aminopeptidase
• CPQ
• EC 3.4.17
• EC 3.4.17.-
• Hls2
• Lal-1
• PGCP
• plasma glutamate carboxypeptidase

Background

Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPQ