Metadherin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LYRIC Antibody [NBP1-90327] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human placenta shows moderate to strong cytoplasmic positivity in decidual cells.

Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90327] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.

Staining of human tonsil shows moderate to strong cytoplasmic positivity in non - germinal center cells.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Western Blot: LYRIC Antibody [NBP1-90327] - Analysis using Anti-MTDH antibody NBP1-90327 (A) shows similar pattern to independent antibody NBP1-90328 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Metadherin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Metadherin Antibody - BSA Free (NBP1-90327) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Metadherin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPA
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTDH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Metadherin Recombinant Protein Antigen (NBP1-90327PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24963474).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Metadherin Antibody - BSA Free

• 3D3
• AEG1
• AEG-13D3/LYRIC
• AEG1LYRIC/3D3
• Astrocyte elevated gene-1 protein
• LYRIC
• LYRICMetastasis adhesion protein
• Lysine-rich CEACAM1 co-isolated protein
• Metadherin
• MTDH
• protein LYRIC

Background

LYRIC is a type II membrane protein, the precise role of which has yet to be defined. It is expressed in breast and prostate carcinoma and is a potential mediator of lung metastasis. It has also been found in mouse Purkinje neurons and cerebellum. In epithelial cells it is recruited to tight junctions (TJ) during the maturation of the TJ complexes. LYRIC co-localizes with beta-catenin in normal and tumour tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Metadherin Antibody (NBP1-90327)(2)

Publications using NBP1-90327

• Giopanou I, Bravou V, Papanastasopoulos P et al. Metadherin, p50, and p65 Expression in Epithelial Ovarian Neoplasms: An Immunohistochemical Study. Biomed Res Int 2014-01-01 [PMID: 24963474] (IF/IHC, Human)
• Nohata N, Hanazawa T, Kikkawa N et al. Tumor suppressive microRNA-375 regulates oncogene AEG-1/MTDH in head and neck squamous cell carcinoma (HNSCC). J Hum Genet 2011-08-01 [PMID: 21753766]

Bioinformatics

• Gene Symbol: MTDH