PEX3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PEX3 Antibody [NBP1-86210] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications Flow, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
Specificity
Specificity of human PEX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in FLOW reported in scientific literature (PMID 28257516).
Control Peptide
Publications
Read Publication using NBP1-86210.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX3 Antibody

  • DKFZp686N14184
  • FLJ13531
  • peroxin-3
  • Peroxisomal assembly protein PEX3
  • peroxisomal biogenesis factor 3
  • transformation-related protein 18
  • TRG18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
8090-ZN
Species: Hu
NBP1-57578
Species: Hu
Applications: WB
NBP2-38443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00008800-Q01
Species: Hu
NBP1-80577
Species: Hu
Applications: WB, ICC/IF
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49876
Species: Hu
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49599
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86406
Species: Hu
Applications: IHC, IHC-P
NBP1-76785
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-93290
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-77122
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PEX3 Antibody (NBP1-86210)(1)

We have publications tested in 1 application: Flow.


Filter By Application
Flow
(1)
All Applications
Filter By Species
All Species

Reviews for PEX3 Antibody (NBP1-86210) (0)

There are no reviews for PEX3 Antibody (NBP1-86210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEX3 Antibody (NBP1-86210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PEX3 Products

Bioinformatics Tool for PEX3 Antibody (NBP1-86210)

Discover related pathways, diseases and genes to PEX3 Antibody (NBP1-86210). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX3 Antibody (NBP1-86210)

Discover more about diseases related to PEX3 Antibody (NBP1-86210).
 

Pathways for PEX3 Antibody (NBP1-86210)

View related products by pathway.

PTMs for PEX3 Antibody (NBP1-86210)

Learn more about PTMs related to PEX3 Antibody (NBP1-86210).

Blogs on PEX3

There are no specific blogs for PEX3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX3
COVID-19 update