Staining of human cell line A-431 shows localization to nucleoplasm & peroxisomes.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human testis shows strong granular cytoplasm positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human adrenal gland shows strong granular cytoplasm positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human kidney shows strong granular cytoplasm positivity in cells in tubules.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human skeletal muscle shows moderate granular cytoplasm positivity in myocytes.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human thyroid gland shows strong granular cytoplasm positivity in glandular cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for PEX3 Antibody - BSA Free
DKFZp686N14184
FLJ13531
peroxin-3
Peroxisomal assembly protein PEX3
peroxisomal biogenesis factor 3
transformation-related protein 18
TRG18
Background
The product of the PEX3 gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PEX3 Antibody - BSA Free and receive a gift card or discount.