PEX3 Antibody

Immunocytochemistry/Immunofluorescence: PEX3 Antibody [NBP1-86210] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human testis shows strong granular cytoplasm positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human adrenal gland shows strong granular cytoplasm positivity in glandular cells.

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human kidney shows strong granular cytoplasm positivity in cells in tubules.

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human skeletal muscle shows moderate granular cytoplasm positivity in myocytes.

Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human thyroid gland shows strong granular cytoplasm positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: Flow, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PEX3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEX3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in FLOW reported in scientific literature (PMID 28257516).
• Control Peptide:

  PEX3 Protein (NBP1-86210PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PEX3 Antibody

• DKFZp686N14184
• FLJ13531
• peroxin-3
• Peroxisomal assembly protein PEX3
• peroxisomal biogenesis factor 3
• transformation-related protein 18
• TRG18

Background

The product of the PEX3 gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEX3 Antibody (NBP1-86210)(1)

Publication using NBP1-86210

• Sychev ZE, Hu A, DiMaio TA et al. Integrated systems biology analysis of KSHV latent infection reveals viral induction and reliance on peroxisome mediated lipid metabolism. PLoS Pathog. 2017-03-01 [PMID: 28257516] (FLOW)

Bioinformatics

• Gene Symbol: PEX3