Novus Biologicals products are now on bio-techne.com

PEX3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PEX3 Antibody [NBP1-86210] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human testis shows strong granular cytoplasm positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human adrenal gland shows strong granular cytoplasm positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human kidney shows strong granular cytoplasm positivity in cells in tubules.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human skeletal muscle shows moderate granular cytoplasm positivity in myocytes.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human thyroid gland shows strong granular cytoplasm positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications Flow, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in FLOW reported in scientific literature (PMID 28257516).
Control Peptide
PEX3 Protein (NBP1-86210PEP)
Publications
Read Publication using NBP1-86210.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX3 Antibody

  • DKFZp686N14184
  • FLJ13531
  • peroxin-3
  • Peroxisomal assembly protein PEX3
  • peroxisomal biogenesis factor 3
  • transformation-related protein 18
  • TRG18

Background

The product of the PEX3 gene is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause Zellweger syndrome (ZWS). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: IHC, IHC-P, WB
8090-ZN
Species: Hu
Applications: EnzAct
NBP1-57578
Species: Hu
Applications: WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00008800-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80955
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49599
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-86321
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-17128
Species: Hu
Applications: IHC, IHC-P
NBP1-88622
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-93290
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-77122
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for PEX3 Antibody (NBP1-86210)(1)

We have publications tested in 1 application: FLOW.


Filter By Application
FLOW
(1)
All Applications
Filter By Species
All Species

Reviews for PEX3 Antibody (NBP1-86210) (0)

There are no reviews for PEX3 Antibody (NBP1-86210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEX3 Antibody (NBP1-86210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX3