PEX1 Antibody - BSA Free

Western Blot: PEX1 Antibody [NBP1-80577] - Analysis in human cell line AN3-CA.

Immunocytochemistry/Immunofluorescence: PEX1 Antibody [NBP1-80577] - Staining of human cell line A-431 shows positivity in vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PEX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PEX1 Antibody - BSA Free (NBP1-80577) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-PEX1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADISIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESFQNPKRRKNQSGTMFRPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PEX1 Protein (NBP1-80577PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PEX1 Antibody - BSA Free

• peroxin-1
• peroxisomal biogenesis factor 1
• Peroxisome biogenesis disorder protein 1
• peroxisome biogenesis factor 1
• Zellweger syndrome 1
• Zellweger syndrome
• ZWS
• ZWS1

Background

PEX1, also known as Peroxisome biogenesis factor 1, is a 1,283 amino acid protein that is 143 kDa, cytoplasmic but is often anchored to a peroxisomal membrane where it forms a heteromeric complex and plays a role in the import of proteins into peroxisomes and peroxisome biogenesis. This protein is currently being studied for research on the following disease and disorders: Zellweger syndrome, peroxisomal biogenesis disorder, peroxisome biogenesis disorders, peroxisome biogenesis factor, Infantile Refsum Disease, Zellweger syndrome-1, refsum disease, neonatal adrenoleukodystrophy, adrenoleukodystrophy, peroxisome biogenesis disorders, Zellweger syndrome spectrum, peroxisome biogenesis disorders (pbd), Werdnig-Hoffmann disease, rhizomelic chondrodysplasia punctate, chondrodysplasia punctate, mulibrey nanism, chondrodysplasia, osteoporosis, hepatocellular carcinoma, and lung carcinoma. PEX1protein involvement has been observed with relation to HIST1H2BC, HIST1H2BE, HIST1H2BF, HIST1H2BG, and HIST1H2BI in peroxisome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEX1 Antibody (NBP1-80577)(3)

Publications using NBP1-80577

• Wu CT, Lidsky PV, Xiao Y et al. SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming Cell 2022-12-01 [PMID: 36580912]
• Wu T, Dong J, Fu J et al. The mechanism of acentrosomal spindle assembly in human oocytes Science (New York, N.Y.) 2022-11-18 [PMID: 36395215]
• Pedrosa AG, Francisco T, Bicho D et al. Peroxisomal monoubiquitinated PEX5 interacts with the AAA ATPases PEX1 and PEX6 and is unfolded during its dislocation into the cytosol J. Biol. Chem. 2018-06-08 [PMID: 29884772] (WB)

Bioinformatics

• Gene Symbol: PEX1
• Entrez:
  • 5189(Human)