Orthogonal Strategies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using NBP1-87258 antibody. Corresponding ABCD3 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP1-87258] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Orthogonal Strategies: Western Blot- PMP70 Antibody [NBP1-87258] - Analysis in human cell lines RT-4 and MCF-7 using Anti-ABCD3 antibody. Corresponding ABCD3 RNA-seq data are presented for the same cell lines. ...read more
Novus Biologicals Rabbit PMP70 Antibody - BSA Free (NBP1-87258) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PMP70 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
Marker
Proxisomal Membrane Marker
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 28969390). Porcine reactivity reported in scientific literature (PMID: 29187542).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for PMP70 Antibody - BSA Free
70 kDa peroxisomal membrane protein
ABC43
ATP-binding cassette, sub-family D (ALD), member 3
peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
Peroxisomal membrane protein-1 (70kD)
PMP70ATP-binding cassette sub-family D member 3
PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
ZWS2
Background
PMP70 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PMP70 Antibody - BSA Free and receive a gift card or discount.