PMP70 Antibody

Immunocytochemistry/Immunofluorescence: PMP70 Antibody [NBP1-87258] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using anti-ABCD3 antibody. Corresponding ABCD3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human colon, kidney, liver and skeletal muscle using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein distribution across tissues to independent antibody NBP2-38199 (B).

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human colon.

• Reactivity: Hu, Mu, Po, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PMP70 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
• Marker: Proxisomal Membrane Marker
• Specificity: Specificity of human, mouse, porcine PMP70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: ICC/IF reported in scientific literature (PMID: 28969390). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25802834). Mouse reactivity reported in scientific literature (PMID: 28969390). Porcine reactivity reported in scientific literature (PMID: 29187542).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PMP70 Antibody

• 70 kDa peroxisomal membrane protein
• ABC43
• ATP-binding cassette, sub-family D (ALD), member 3
• peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
• Peroxisomal membrane protein-1 (70kD)
• PMP70ATP-binding cassette sub-family D member 3
• PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
• ZWS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PMP70 Antibody (NBP1-87258)(4)

Publications using NBP1-87258

• Burgoyne T, Lane A, Laughlin WE et al. Correlative light and immuno-electron microscopy of retinal tissue cryostat sections PLoS ONE 2018 Jan 09 [PMID: 29315318] (Mouse)
• Zhang Q, Ke H, Blikslager A et al. Type III Interferon Restriction by Porcine Epidemic Diarrhea Virus and the Role of Viral Protein nsp1 in IRF1 Signaling. J. Virol. 2017 Nov 29 [PMID: 29187542] (ICC/IF, Porcine)
• Gerber S, Charif M, Chevrollier A et al. Mutations in DNM1L, as in OPA1, result indominant optic atrophy despite opposite effectson mitochondrial fusion and fission Brain 2017 Oct 01 [PMID: 28969390] (ICC/IF, Mouse)
• Reams RR, Jones-Triche J, Chan OT et al. Immunohistological Analysis of ABCD3 Expression in Caucasian and African American Prostate Tumors. Biomed Res Int 2015 [PMID: 25802834] (IHC, Human)

Bioinformatics

• Gene Symbol: ABCD3