Home » PMP70 » PMP70 Antibodies » PMP70 Antibody

PMP70 Antibody

 (5 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using NBP1-87258 antibody. Corresponding ABCD3 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using NBP1-87258 antibody. Corresponding ABCD3 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP1-87258] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, Po, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

PMP70 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
Marker
Proxisomal Membrane Marker
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot
Application Notes
Use in Western Blot reported in scientific literature (PMID:32768229). ICC/IF reported in scientific literature (PMID: 28969390). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PMP70 Protein (NBP1-87258PEP)
Publications
Read Publications using
NBP1-87258 in the following applications:

  • ICC/IF
    3 publications
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25802834). Mouse reactivity reported in scientific literature (PMID: 28969390). Porcine reactivity reported in scientific literature (PMID: 29187542).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMP70 Antibody

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCD1 Antibody
(OTI2C12)
NBP2-46476
Knockdown Validated: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Western blot shows lysates of TIME human endothelial parental cell line and ABCD1 knockout (KO) TIME cell line. PVDF membrane was probed with 1:2000 of Mouse Anti-Human ABCD1 Monoclonal Antibody (Catalog # NBP2-46476) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for ABCD1 at approximately 75 kDa (as indicated) in the parental TIME cell line, but is not detectable in the knockout TIME cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: ABCD1 Antibody (OTI2C12) [NBP2-46476] - Analysis of Carcinoma of Human lung tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
ABCD2 Antibody
NBP2-92633
Immunocytochemistry/Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of U-2 OS cells using ABCD2 . Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: ABCD2 Antibody [NBP2-92633] - Analysis of L929 cells using ABCD2 . Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ABCD4 Antibody
NBP2-21601
Immunocytochemistry/Immunofluorescence: ABCD4 Antibody [NBP2-21601] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: ABCD4 protein stained by ABCD4 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: ABCD4 Antibody [NBP2-21601] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: ABCD4 Antibody [NBP2-21601] - Immunohistochemical analysis of paraffin-embedded AGS xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
PXMP3 Antibody
NBP2-94643
Western Blot: PXMP3 Antibody [NBP2-94643] - Analysis of extracts of various cell lines, using PXMP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 20s.
Immunohistochemistry-Paraffin: PXMP3 Antibody [NBP2-94643] - Immunohistochemistry of paraffin-embedded human placenta using PXMP3 Rabbit pAb (NBP2-94643) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PXMP2
Overexpression Lysate
NBL1-15012
Western Blot: PXMP2 Overexpression Lysate (Adult Normal) [NBL1-15012] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for PXMP2.
Species: Hu
Applications: WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(12 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
ACOX1 Antibody
NBP1-80950
Immunocytochemistry/Immunofluorescence: ACOX1 Antibody [NBP1-80950] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACOX1 Antibody [NBP1-80950] - Staining of human gastrointestinal, kidney, liver and pancreas using Anti-ACOX1 antibody NBP1-80950 (A) shows similar protein distribution across tissues to independent antibody NBP1-80949 (B).
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PEX14 Antibody
NBP2-33455
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human liver shows moderate cytoplasmic granular positivity in hepatocytes.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PEX19 Antibody
NBP1-32925
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301 was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PEX19 Antibody [NBP1-32925] - Methanol-fixed HeLa antibody (Green) at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PMP22 Antibody
(Hu1)
NB110-59086
Immunohistochemistry: PMP22 Antibody (Hu1) [NB110-59086] - Staining of PMP22 (brown) in dorsal root ganglion and spinal roots in 20 week fetal spinal cord preparation from rhesus monkey.
(1 Publication)
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC: MRP1 Antibody (IU2H10) [NB400-156] - Formalin-fixed paraffin-embedded tissue sections of human testis were probed for MRP1 mRNA (ACD RNAScope Probe, catalog # 435591; Fast Red chromogen, ACD catalog # 322360). Adjacent tissue section was processed for immunohistochemistry using mouse monoclonal (Novus Biologicals catalog # NB400-156) at 7ug/mL with overnight incubation at 4 degrees Celsius followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to Leydig cells and seminiferous tubule cells.
Western Blot: MRP1 Antibody (IU2H10) [NB400-156] - Vector-transfected HEK293 cells 2: MRP1-transfected cells, prep1 3: MRP1-transfected cells, prep2 (the lower band is a degradation product.)
Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU2H10) [NB400-156] - The MRP-1 antibody was tested in HeLa cells at a 1:50 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
GNPAT Antibody
H00008443-B01P
Western Blot: GNPAT Antibody [H00008443-B01P] - Analysis of GNPAT expression in transfected 293T cell line by GNPAT polyclonal antibody. Lane 1: GNPAT transfected lysate(74.8 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GNPAT Antibody [H00008443-B01P] - Analysis of purified antibody to GNPAT on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB
ABCA4 Antibody
(3F4)
NBP1-30032
Western Blot: ABCA4 Antibody (3F4) [NBP1-30032] - Characterization of ABCA4 mRNA expression and western blot analyses of ABCA4 protein levels in the canine retina. Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1007873), licensed under a CC-BY licence.
Immunohistochemistry: ABCA4 Antibody (3F4) [NBP1-30032] - Fluorescence histochemistry of ABCA4, cone photoreceptors, and autofluorescence in the canine retina. Fluorescence micrographs showing ABCA4 expression (red), FITC-conjugated peanut agglutinin (PNA, green), and DAPI nuclear staining (blue) in wild-type (ABCA4+/+) retina. PNA labels cone photoreceptors. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1007873), licensed under a CC-BY licence.
Immunohistochemistry: ABCA4 Antibody (3F4) [NBP1-30032] - Fluorescence histochemistry of ABCA4, cone photoreceptors, and autofluorescence in the canine retina. Fluorescence micrographs showing ABCA4 expression (red), FITC-conjugated peanut agglutinin (PNA, green), and DAPI nuclear staining (blue) in affected (ABCA4-/-) retina. PNA labels cone photoreceptors. Autofluorescence, indicative of lipofuscin accumulation, was seen in the ABCA4-/- RPE. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1007873), licensed under a CC-BY licence.
(1 Review)
(5 Publications)
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
PEX5 Antibody
NBP1-87185
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human lymph node using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(12 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Myelin PLP Antibody
NBP1-87781
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Myelin PLP Antibody [NBP1-87781] - Staining in human cerebral cortex and pancreas tissues using anti-PLP1 antibody. Corresponding PLP1 RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for PMP70 Antibody (NBP1-87258)(5)

We have publications tested in 4 confirmed species: Human, Mouse, Pocine, Porcine.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(3)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
Pocine
(1)
Porcine
(1)
All Species

Reviews for PMP70 Antibody (NBP1-87258) (0)

There are no reviews for PMP70 Antibody (NBP1-87258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PMP70 Antibody (NBP1-87258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMP70 Products

Array NBP1-87258

Bioinformatics Tool for PMP70 Antibody (NBP1-87258)

Discover related pathways, diseases and genes to PMP70 Antibody (NBP1-87258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP70 Antibody (NBP1-87258)

Discover more about diseases related to PMP70 Antibody (NBP1-87258).
 

Pathways for PMP70 Antibody (NBP1-87258)

View related products by pathway.

PTMs for PMP70 Antibody (NBP1-87258)

Learn more about PTMs related to PMP70 Antibody (NBP1-87258).
 

Research Areas for PMP70 Antibody (NBP1-87258)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMP70 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCD3