PMP70 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using NBP1-87258 antibody. Corresponding ABCD3 RNA-seq data are presented more
Independent Antibodies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP1-87258] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, Po, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PMP70 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
Proxisomal Membrane Marker
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot
Application Notes
Use in Western Blot reported in scientific literature (PMID:32768229). ICC/IF reported in scientific literature (PMID: 28969390). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PMP70 Protein (NBP1-87258PEP)
Read Publications using
NBP1-87258 in the following applications:

  • 3 publications
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25802834). Mouse reactivity reported in scientific literature (PMID: 28969390). Porcine reactivity reported in scientific literature (PMID: 29187542).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PMP70 Antibody

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for PMP70 Antibody (NBP1-87258)(5)

Reviews for PMP70 Antibody (NBP1-87258) (0)

There are no reviews for PMP70 Antibody (NBP1-87258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PMP70 Antibody (NBP1-87258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PMP70 Products

Array NBP1-87258

Bioinformatics Tool for PMP70 Antibody (NBP1-87258)

Discover related pathways, diseases and genes to PMP70 Antibody (NBP1-87258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP70 Antibody (NBP1-87258)

Discover more about diseases related to PMP70 Antibody (NBP1-87258).

Pathways for PMP70 Antibody (NBP1-87258)

View related products by pathway.

PTMs for PMP70 Antibody (NBP1-87258)

Learn more about PTMs related to PMP70 Antibody (NBP1-87258).

Research Areas for PMP70 Antibody (NBP1-87258)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PMP70 Antibody and receive a gift card or discount.


Gene Symbol ABCD3