PMP70 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using NBP1-87258 antibody. Corresponding ABCD3 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: PMP70 Antibody [NBP1-87258] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, Po, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMP70 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
Marker
Proxisomal Membrane Marker
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot
Application Notes
Use in Western Blot reported in scientific literature (PMID:32768229). ICC/IF reported in scientific literature (PMID: 28969390). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PMP70 Protein (NBP1-87258PEP)
Publications
Read Publications using
NBP1-87258 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25802834). Mouse reactivity reported in scientific literature (PMID: 28969390). Porcine reactivity reported in scientific literature (PMID: 29187542).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMP70 Antibody

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Background

PMP70 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC, KD, KO, WB
NBP2-92633
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-94643
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBL1-15012
Species: Hu
Applications: WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
H00008443-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for PMP70 Antibody (NBP1-87258)(5)

Reviews for PMP70 Antibody (NBP1-87258) (0)

There are no reviews for PMP70 Antibody (NBP1-87258). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PMP70 Antibody (NBP1-87258) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMP70 Products

Array NBP1-87258

Bioinformatics Tool for PMP70 Antibody (NBP1-87258)

Discover related pathways, diseases and genes to PMP70 Antibody (NBP1-87258). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP70 Antibody (NBP1-87258)

Discover more about diseases related to PMP70 Antibody (NBP1-87258).
 

Pathways for PMP70 Antibody (NBP1-87258)

View related products by pathway.

PTMs for PMP70 Antibody (NBP1-87258)

Learn more about PTMs related to PMP70 Antibody (NBP1-87258).
 

Research Areas for PMP70 Antibody (NBP1-87258)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD3