PMP70 Antibody

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining in human liver and skeletal muscle tissues using NBP1-87258 antibody. Corresponding ABCD3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein distribution across tissues to independent antibody NBP2-38199 (B).

Immunocytochemistry/Immunofluorescence: PMP70 Antibody [NBP1-87258] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Po, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PMP70 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
• Marker: Proxisomal Membrane Marker
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot
• Application Notes: Use in Western Blot reported in scientific literature (PMID:32768229). ICC/IF reported in scientific literature (PMID: 28969390). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PMP70 Protein (NBP1-87258PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25802834). Mouse reactivity reported in scientific literature (PMID: 28969390). Porcine reactivity reported in scientific literature (PMID: 29187542).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PMP70 Antibody

• 70 kDa peroxisomal membrane protein
• ABC43
• ATP-binding cassette, sub-family D (ALD), member 3
• peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
• Peroxisomal membrane protein-1 (70kD)
• PMP70ATP-binding cassette sub-family D member 3
• PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
• ZWS2

Background

PMP70 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PMP70 Antibody (NBP1-87258)(5)

Publications using NBP1-87258

• Liu S, Fang P, Ke W et al. Porcine deltacoronavirus (PDCoV) infection antagonizes interferon-gamma 1 production. Vet Microbiol 2020-08-02 [PMID: 32768229] (ICC/IF, WB, Porcine)
• Burgoyne T, Lane A, Laughlin WE et al. Correlative light and immuno-electron microscopy of retinal tissue cryostat sections PLoS ONE 2018-01-09 [PMID: 29315318] (Mouse)
• Zhang Q, Ke H, Blikslager A et al. Type III Interferon Restriction by Porcine Epidemic Diarrhea Virus and the Role of Viral Protein nsp1 in IRF1 Signaling. J. Virol. 2017-11-29 [PMID: 29187542] (ICC/IF, Porcine)
• Gerber S, Charif M, Chevrollier A et al. Mutations in DNM1L, as in OPA1, result indominant optic atrophy despite opposite effectson mitochondrial fusion and fission Brain 2017-10-01 [PMID: 28969390] (ICC/IF, Mouse)
• Reams RR, Jones-Triche J, Chan OT et al. Immunohistological Analysis of ABCD3 Expression in Caucasian and African American Prostate Tumors. Biomed Res Int 2015-01-01 [PMID: 25802834] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: ABCD3