PXMP3 Antibody - Azide and BSA Free

Images

 
Western Blot: PXMP3 Antibody [NBP2-94643] - Analysis of extracts of various cell lines, using PXMP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more
Immunohistochemistry-Paraffin: PXMP3 Antibody [NBP2-94643] - Immunohistochemistry of paraffin-embedded human placenta using PXMP3 Rabbit pAb (NBP2-94643) at dilution of 1:100 (40x lens). Perform high pressure antigen ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PXMP3 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEX2 (NP_001165558.1). MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:200 - 1:2000
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for PXMP3 Antibody - Azide and BSA Free

  • PAF-1
  • PAF1peroxisomal membrane protein 3 (35kD, Zellweger syndrome)
  • Peroxin-2
  • peroxisomal biogenesis factor 2,35 kDa peroxisomal membrane protein
  • Peroxisomal membrane protein 3
  • peroxisomal membrane protein 3, 35kDa
  • Peroxisome assembly factor 1
  • peroxisome biogenesis factor 2
  • PMP35PMP3
  • PXMP3peroxisome assembly factor-1
  • RNF72RING finger protein 72
  • ZWS3

Background

PXMP3 encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-184
Species: Hu, Mu
Applications: IP, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
NB100-61052
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-57578
Species: Hu
Applications: WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NB100-68205
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80955
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-42854
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49599
Species: Hu
Applications: IHC, IHC-P, WB
8090-ZN
Species: Hu
Applications: EnzAct
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB600-276
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB100-2242
Species: Hu, Mu
Applications: ChIP, IP, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-558
Species: Hu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB

Publications for PXMP3 Antibody (NBP2-94643) (0)

There are no publications for PXMP3 Antibody (NBP2-94643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PXMP3 Antibody (NBP2-94643) (0)

There are no reviews for PXMP3 Antibody (NBP2-94643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PXMP3 Antibody (NBP2-94643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PXMP3 Products

Diseases for PXMP3 Antibody (NBP2-94643)

Discover more about diseases related to PXMP3 Antibody (NBP2-94643).
 

Pathways for PXMP3 Antibody (NBP2-94643)

View related products by pathway.

PTMs for PXMP3 Antibody (NBP2-94643)

Learn more about PTMs related to PXMP3 Antibody (NBP2-94643).
 

Research Areas for PXMP3 Antibody (NBP2-94643)

Find related products by research area.

Blogs on PXMP3

There are no specific blogs for PXMP3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PXMP3 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX2