PEX5 Antibody

Images

 
Western Blot: PEX5 Antibody [NBP1-87185] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP1-87185] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Western Blot: PEX5 Antibody [NBP1-87185] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEX5 Protein (NBP1-87185PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX5 Antibody

  • FLJ50634
  • FLJ50721
  • Peroxin-5
  • peroxisomal biogenesis factor 5
  • Peroxisomal C-terminal targeting signal import receptor
  • peroxisomal targeting signal 1 receptor
  • peroxisomal targeting signal import receptor
  • peroxisomal targeting signal receptor 1
  • Peroxisome receptor 1peroxin-5
  • PTS1 receptor
  • PTS1-BP
  • PTS1RFLJ51948
  • PXR1peroxisomal targeting signal 1 (SKL type) receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57578
Species: Hu
Applications: WB
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49599
Species: Hu
Applications: WB, IHC
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
8090-ZN
Species: Hu
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38840
Species: Hu
Applications: IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-36770
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008443-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for PEX5 Antibody (NBP1-87185) (0)

There are no publications for PEX5 Antibody (NBP1-87185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX5 Antibody (NBP1-87185) (0)

There are no reviews for PEX5 Antibody (NBP1-87185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PEX5 Antibody (NBP1-87185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX5 Products

Bioinformatics Tool for PEX5 Antibody (NBP1-87185)

Discover related pathways, diseases and genes to PEX5 Antibody (NBP1-87185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX5 Antibody (NBP1-87185)

Discover more about diseases related to PEX5 Antibody (NBP1-87185).
 

Pathways for PEX5 Antibody (NBP1-87185)

View related products by pathway.

PTMs for PEX5 Antibody (NBP1-87185)

Learn more about PTMs related to PEX5 Antibody (NBP1-87185).

Blogs on PEX5

There are no specific blogs for PEX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX5
Entrez