Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA |
Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PEX5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-87185 | Applications | Species |
---|---|---|
Balakrishnan A, Adnani L, Chinchalongporn V et al. SMPD3-mediated extracellular vesicle biogenesis inhibits oligodendroglioma growth bioRxiv Jul 15 2020 (WB) | WB | |
Chen BH, Chang YJ, Lin S, Yang WY Hsc70/Stub1 promotes the removal of individual oxidatively stressed peroxisomes Nat Commun Oct 19 2020 [PMID: 33077711] (WB, Mouse) | WB | Mouse |
Balakrishnan A Glial cells in health and disease Thesis Jan 1 2020 (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for PEX5 Antibody (NBP1-87185)Discover more about diseases related to PEX5 Antibody (NBP1-87185).
| Pathways for PEX5 Antibody (NBP1-87185)View related products by pathway.
|
PTMs for PEX5 Antibody (NBP1-87185)Learn more about PTMs related to PEX5 Antibody (NBP1-87185).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.