Home » PEX5 » PEX5 Antibodies » PEX5 Antibody

PEX5 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP1-87185 (A) shows similar protein distribution across tissues to independent antibody NBP2-38443 (B).
Independent Antibodies: Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP1-87185 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: PEX5 Antibody [NBP1-87185] - Analysis using Anti-PEX5 antibody NBP1-87185 (A) shows similar pattern to independent antibody NBP2-38443 (B).
Western Blot: PEX5 Antibody [NBP1-87185] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP1-87185] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human testis using Anti-PEX5 antibody NBP1-87185.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human lymph node using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon using Anti-PEX5 antibody NBP1-87185.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human testis using Anti-PEX5 antibody NBP1-87185.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

PEX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEX5 Protein (NBP1-87185PEP)
Publications
Read Publications using
NBP1-87185 in the following applications:

  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX5 Antibody

  • FLJ50634
  • FLJ50721
  • Peroxin-5
  • peroxisomal biogenesis factor 5
  • Peroxisomal C-terminal targeting signal import receptor
  • peroxisomal targeting signal 1 receptor
  • peroxisomal targeting signal import receptor
  • peroxisomal targeting signal receptor 1
  • Peroxisome receptor 1peroxin-5
  • PTS1 receptor
  • PTS1-BP
  • PTS1RFLJ51948
  • PXR1peroxisomal targeting signal 1 (SKL type) receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PEX7 Antibody
NBP1-57578
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
PEX14 Antibody
NBP2-33455
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human liver shows moderate cytoplasmic granular positivity in hepatocytes.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
PXMP3 Antibody
NBP2-94643
Western Blot: PXMP3 Antibody [NBP2-94643] - Analysis of extracts of various cell lines, using PXMP3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 20s.
Species: Hu, Mu, Rt
Applications: IHC, WB
PTS Antibody
NBP1-32975
Western Blot: PTS Antibody [NBP1-32975] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with PTS antibody diluted at 1:5000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: PTS Antibody [NBP1-32975] - Wild-type (WT) and PTS knockout (KO) HeLa cell extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with PTS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PTS Antibody [NBP1-32975] - Analysis of methanol-fixed HeLa, using antibody at 1:100 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PEX13 Antibody
NBP1-86321
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining in human testis and pancreas tissues using anti-PEX13 antibody. Corresponding PEX13 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
PEX12 Antibody
NBP2-49599
Western Blot: PEX12 Antibody [NBP2-49599] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining of human bone marrow shows low expression as expected.
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining in human epididymis and bone marrow tissues using anti-PEX12 antibody. Corresponding PEX12 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
PEX6 Antibody
NBP1-80955
Western Blot: PEX6 Antibody [NBP1-80955] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding PEX6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PEX6 Antibody [NBP1-80955] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PEX1 Antibody
NBP1-80577
Western Blot: PEX1 Antibody [NBP1-80577] - Analysis in human cell line AN3-CA.
Immunocytochemistry/Immunofluorescence: PEX1 Antibody [NBP1-80577] - Staining of human cell line A-431 shows positivity in vesicles. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
ZNF260 Antibody
NBP1-80967
Immunohistochemistry-Paraffin: ZNF260 Antibody [NBP1-80967] - Staining of human stomach shows strong nuclear and additional cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ZNF260 Antibody [NBP1-80967] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PHEX
8090-ZN
PHEX
Species: Hu
Applications: EnzAct
PEX10 Antibody -
BSA Free
NBP3-18137
Western Blot: PEX10 Antibody - BSA Free [NBP3-18137] - WB Validation in Human and Mouse Cell Lines. Loading: 15 ug of lysate Antibodies: PEX10 NBP3-18137, 4 ug/mL , 1 h incubation at RT in 5% NFDM/TBST. Secondary: Goat Anti-Rabbit IgG HRP conjugate at 1:10,000 dilution.
Western Blot: PEX10 Antibody - BSA Free [NBP3-18137] - WB Validation in Mouse Tissues. Loading: 15 ug of lysates per lane. Antibodies: PEX10 NBP3-18137, 4 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Western Blot: PEX10 Antibody - BSA Free [NBP3-18137] - WB Validation in Rat Tissues. Loading: 15 ug of lysates per lane. Antibodies: PEX10 NBP3-18137, 4 ug/mL, 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10,000 dilution.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
TPR Antibody
NB100-2866
Immunocytochemistry/Immunofluorescence: TPR Antibody [NB100-2866] - TPR and Mad1 interaction at the Nuclear Pores (green dots). DNA counterstained with DAPI (blue). Image submitted by a verified customer review.
Knockdown Validated: TPR Antibody [NB100-2866] - Lane 1 contians wildtype MDA-MB-231 cell lysate nuclear extract. Lanes 2, 3 and 4 contain the TPR knocked down MDA-MB-231 cell lysate nuclear extract. The lowered intensity of the bands in knocked down cell lines compared to wildtype supports antibody specificity to intended target protein. Image was submitted by customer review.
Western Blot: TPR Antibody [NB100-2866] - Whole cell lysate from HeLa (5, 15 and 50 ug) and HEK293T (T; 50 ug) cells. Antibodies: Affinity purified rabbit anti-TPR antibody used for WB at 0.04 ug/ml. Detection: Chemiluminescence with exposure time of 30 seconds.
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ICC/IF, IP, KD, WB
PEX19 Antibody
NBP1-32925
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: PEX19 Antibody [NBP1-32925] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with PEX19 antibody diluted at 1:10000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301 was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PEX19 Antibody [NBP1-32925] - Methanol-fixed HeLa antibody (Green) at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PEX5L Antibody
NBP2-38840
Immunohistochemistry: PEX5L Antibody [NBP2-38840] - Staining of human cerebellum shows distinct positivity in subsets of glial cells.
Immunohistochemistry-Paraffin: PEX5L Antibody [NBP2-38840] - Staining of human anterior pituitary gland shows strong cytoplasmic positivity in endocrine cells.
Immunohistochemistry-Paraffin: PEX5L Antibody [NBP2-38840] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: IHC, IHC-P
PEX3 Antibody
NBP1-86210
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human adrenal gland shows strong granular cytoplasm positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human kidney shows strong granular cytoplasm positivity in cells in tubules.
Immunohistochemistry-Paraffin: PEX3 Antibody [NBP1-86210] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
PMP70 Antibody
NBP1-87258
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human kidney, liver, skeletal muscle and testis using Anti-ABCD3 antibody NBP1-87258 (A) shows similar protein distribution across tissues to independent antibody NBP2-38199 (B).
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PMP70 Antibody [NBP1-87258] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.
(5 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
GNPAT Antibody
H00008443-B01P
Western Blot: GNPAT Antibody [H00008443-B01P] - Analysis of GNPAT expression in transfected 293T cell line by GNPAT polyclonal antibody. Lane 1: GNPAT transfected lysate(74.8 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GNPAT Antibody [H00008443-B01P] - Analysis of purified antibody to GNPAT on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB

Publications for PEX5 Antibody (NBP1-87185)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-87185 Applications Species
Balakrishnan A, Adnani L, Chinchalongporn V et al. SMPD3-mediated extracellular vesicle biogenesis inhibits oligodendroglioma growth bioRxiv Jul 15 2020 (WB) WB
Chen BH, Chang YJ, Lin S, Yang WY Hsc70/Stub1 promotes the removal of individual oxidatively stressed peroxisomes Nat Commun Oct 19 2020 [PMID: 33077711] (WB, Mouse) WB Mouse
Balakrishnan A Glial cells in health and disease Thesis Jan 1 2020 (WB, Human) WB Human

Reviews for PEX5 Antibody (NBP1-87185) (0)

There are no reviews for PEX5 Antibody (NBP1-87185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PEX5 Antibody (NBP1-87185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX5 Products

Bioinformatics Tool for PEX5 Antibody (NBP1-87185)

Discover related pathways, diseases and genes to PEX5 Antibody (NBP1-87185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX5 Antibody (NBP1-87185)

Discover more about diseases related to PEX5 Antibody (NBP1-87185).
 

Pathways for PEX5 Antibody (NBP1-87185)

View related products by pathway.

PTMs for PEX5 Antibody (NBP1-87185)

Learn more about PTMs related to PEX5 Antibody (NBP1-87185).

Blogs on PEX5

There are no specific blogs for PEX5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PEX5
Entrez