PEX5 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP1-87185 (A) shows similar protein ...read more
Independent Antibodies: Western Blot: PEX5 Antibody [NBP1-87185] - Analysis using Anti-PEX5 antibody NBP1-87185 (A) shows similar pattern to independent antibody NBP2-38443 (B).
Western Blot: PEX5 Antibody [NBP1-87185] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP1-87185] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human testis using Anti-PEX5 antibody NBP1-87185.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human lymph node using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon using Anti-PEX5 antibody NBP1-87185.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human testis using Anti-PEX5 antibody NBP1-87185.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PEX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEX5 Protein (NBP1-87185PEP)
Publications
Read Publications using
NBP1-87185 in the following applications:

  • WB
    3 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX5 Antibody

  • FLJ50634
  • FLJ50721
  • Peroxin-5
  • peroxisomal biogenesis factor 5
  • Peroxisomal C-terminal targeting signal import receptor
  • peroxisomal targeting signal 1 receptor
  • peroxisomal targeting signal import receptor
  • peroxisomal targeting signal receptor 1
  • Peroxisome receptor 1peroxin-5
  • PTS1 receptor
  • PTS1-BP
  • PTS1RFLJ51948
  • PXR1peroxisomal targeting signal 1 (SKL type) receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57578
Species: Hu
Applications: WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-32975
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86321
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-49599
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80955
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
Applications: EnzAct
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38840
Species: Hu
Applications: IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
H00008443-B01P
Species: Hu
Applications: ICC/IF, WB

Publications for PEX5 Antibody (NBP1-87185)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-87185 Applications Species
Balakrishnan A, Adnani L, Chinchalongporn V et al. SMPD3-mediated extracellular vesicle biogenesis inhibits oligodendroglioma growth bioRxiv Jul 15 2020 (WB) WB
Chen BH, Chang YJ, Lin S, Yang WY Hsc70/Stub1 promotes the removal of individual oxidatively stressed peroxisomes Nat Commun Oct 19 2020 [PMID: 33077711] (WB, Mouse) WB Mouse
Balakrishnan A Glial cells in health and disease Thesis Jan 1 2020 (WB, Human) WB Human

Reviews for PEX5 Antibody (NBP1-87185) (0)

There are no reviews for PEX5 Antibody (NBP1-87185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PEX5 Antibody (NBP1-87185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX5 Products

Bioinformatics Tool for PEX5 Antibody (NBP1-87185)

Discover related pathways, diseases and genes to PEX5 Antibody (NBP1-87185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX5 Antibody (NBP1-87185)

Discover more about diseases related to PEX5 Antibody (NBP1-87185).
 

Pathways for PEX5 Antibody (NBP1-87185)

View related products by pathway.

PTMs for PEX5 Antibody (NBP1-87185)

Learn more about PTMs related to PEX5 Antibody (NBP1-87185).

Blogs on PEX5

There are no specific blogs for PEX5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX5
Entrez