PEX5 Antibody

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP1-87185 (A) shows similar protein distribution across tissues to independent antibody NBP2-38443 (B).

Western Blot: PEX5 Antibody [NBP1-87185] - Analysis using Anti-PEX5 antibody NBP1-87185 (A) shows similar pattern to independent antibody NBP2-38443 (B).

Western Blot: PEX5 Antibody [NBP1-87185] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: PEX5 Antibody [NBP1-87185] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human testis using Anti-PEX5 antibody NBP1-87185.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human lymph node using Anti-PEX5 antibody.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex using Anti-PEX5 antibody.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon using Anti-PEX5 antibody NBP1-87185.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human testis using Anti-PEX5 antibody NBP1-87185.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PEX5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEX5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PEX5 Protein (NBP1-87185PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PEX5 Antibody

• FLJ50634
• FLJ50721
• Peroxin-5
• peroxisomal biogenesis factor 5
• Peroxisomal C-terminal targeting signal import receptor
• peroxisomal targeting signal 1 receptor
• peroxisomal targeting signal import receptor
• peroxisomal targeting signal receptor 1
• Peroxisome receptor 1peroxin-5
• PTS1 receptor
• PTS1-BP
• PTS1RFLJ51948
• PXR1peroxisomal targeting signal 1 (SKL type) receptor

Background

The product of the PEX5 gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEX5 Antibody (NBP1-87185)(4)

Publications using NBP1-87185

• Fu X, Wan P, Lu L et al. Peroxisome Deficiency in Cochlear Hair Cells Causes Hearing Loss by Deregulating BK Channels Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2023-05-12 [PMID: 37171794] (IHC, WB, Mouse)
• Balakrishnan A, Adnani L, Chinchalongporn V et al. SMPD3-mediated extracellular vesicle biogenesis inhibits oligodendroglioma growth bioRxiv 2020-07-15 (WB)
• Chen BH, Chang YJ, Lin S, Yang WY Hsc70/Stub1 promotes the removal of individual oxidatively stressed peroxisomes Nat Commun 2020-10-19 [PMID: 33077711] (WB, Mouse)
• Balakrishnan A Glial cells in health and disease Thesis 2020-01-01 (WB, Human)

Bioinformatics

• Gene Symbol: PEX5
• Entrez:
  • 5830(Human)