PEX5 Antibody

Western Blot: PEX5 Antibody [NBP1-87185] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: PEX5 Antibody [NBP1-87185] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Western Blot: PEX5 Antibody [NBP1-87185] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PEX5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA
• Specificity: Specificity of human, mouse, rat PEX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEX5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Positive Control:

  PEX5 Lysate (NBP2-65542)

• Control Peptide:

  PEX5 Protein (NBP1-87185PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PEX5 Antibody

• FLJ50634
• FLJ50721
• Peroxin-5
• peroxisomal biogenesis factor 5
• Peroxisomal C-terminal targeting signal import receptor
• peroxisomal targeting signal 1 receptor
• peroxisomal targeting signal import receptor
• peroxisomal targeting signal receptor 1
• Peroxisome receptor 1peroxin-5
• PTS1 receptor
• PTS1-BP
• PTS1RFLJ51948
• PXR1peroxisomal targeting signal 1 (SKL type) receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEX5
• Entrez:
  • 5830(Human)