PEX16 Antibody - BSA Free

Staining of human cerebellum shows moderate membranous positivity in Purkinje cells.

Staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.

Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Staining of human skeletal muscle shows very weak membranous positivity in myocytes.

Lane 1: Mouse liver tissue lysateLane 2: Rat liver tissue lysate

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PEX16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PEX16 Antibody - BSA Free (NBP1-85828) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEX16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PEX16 Protein (NBP1-85828PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PEX16 Antibody - BSA Free

• peroxin-16
• peroxisomal biogenesis factor 16peroxin 16
• peroxisomal membrane protein PEX16
• peroxisome biogenesis factor 16

Background

The protein encoded by the PEX16 gene is an integral peroxisomal membrane protein. An inactivating nonsense mutation localized to this gene was observed in a patient with Zellweger syndrome of the complementation group CGD/CG9. Expression of this gene product morphologically and biochemically restores the formation of new peroxisomes, suggesting a role in peroxisome organization and biogenesis. Alternative splicing has been observed for this gene and two variants have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEX16