PEX13 Antibody

Images

 
Western Blot: PEX13 Antibody [NBP1-86321] - Analysis in control (vector only transfected HEK293T lysate) and PEX13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human colon.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining in human testis and pancreas tissues using anti-PEX13 antibody. Corresponding PEX13 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human colon, kidney, liver and pancreas using Anti-PEX13 antibody NBP1-86321 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human liver.
Immunohistochemistry-Paraffin: PEX13 Antibody [NBP1-86321] - Staining of human kidney.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGA
Specificity
Specificity of human PEX13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX13 Antibody

  • NALD
  • peroxin-13
  • peroxisomal biogenesis factor 13
  • peroxisomal membrane protein PEX13
  • peroxisome biogenesis factor 13
  • ZWS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB
NBP1-87185
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46476
Species: Hu
Applications: WB, IHC
8090-ZN
Species: Hu
NBP2-49599
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-49876
Species: Hu
Applications: WB, PEP-ELISA
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60050
Species: Hu, Mu, Rt, Ca, Eq, GP
Applications: WB
NBP1-80577
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NBP1-59704
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB

Publications for PEX13 Antibody (NBP1-86321) (0)

There are no publications for PEX13 Antibody (NBP1-86321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX13 Antibody (NBP1-86321) (0)

There are no reviews for PEX13 Antibody (NBP1-86321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX13 Antibody (NBP1-86321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PEX13 Products

Bioinformatics Tool for PEX13 Antibody (NBP1-86321)

Discover related pathways, diseases and genes to PEX13 Antibody (NBP1-86321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX13 Antibody (NBP1-86321)

Discover more about diseases related to PEX13 Antibody (NBP1-86321).
 

Pathways for PEX13 Antibody (NBP1-86321)

View related products by pathway.

PTMs for PEX13 Antibody (NBP1-86321)

Learn more about PTMs related to PEX13 Antibody (NBP1-86321).

Blogs on PEX13

There are no specific blogs for PEX13, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX13