PEX12 Antibody

Images

 
Western Blot: PEX12 Antibody [NBP2-49599] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining of human epididymis shows high expression.
Immunohistochemistry: PEX12 Antibody [NBP2-49599] - Staining of human kidney shows strong membranous positivity in renal tubules and glomeruli.
Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining of human bone marrow shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PEX12 Antibody [NBP2-49599] - Staining in human epididymis and bone marrow tissues using anti-PEX12 antibody. Corresponding PEX12 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PEX12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSAL
Specificity
Specificity of human PEX12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PEX12 Recombinant Protein Antigen (NBP2-49599PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX12 Antibody

  • PAF3
  • PAF-3
  • peroxin 12
  • peroxin-12
  • peroxisomal biogenesis factor 12
  • Peroxisome assembly factor 3
  • peroxisome assembly protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94643
Species: Hu, Mu, Rt
Applications: WB
NBP1-87185
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80577
Species: Hu
Applications: WB, ICC/IF
NBP2-38838
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-59705
Species: Hu
Applications: WB
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P
NBP2-30736
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32743
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PEX12 Antibody (NBP2-49599) (0)

There are no publications for PEX12 Antibody (NBP2-49599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX12 Antibody (NBP2-49599) (0)

There are no reviews for PEX12 Antibody (NBP2-49599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX12 Antibody (NBP2-49599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PEX12 Products

Bioinformatics Tool for PEX12 Antibody (NBP2-49599)

Discover related pathways, diseases and genes to PEX12 Antibody (NBP2-49599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX12 Antibody (NBP2-49599)

Discover more about diseases related to PEX12 Antibody (NBP2-49599).
 

Pathways for PEX12 Antibody (NBP2-49599)

View related products by pathway.

PTMs for PEX12 Antibody (NBP2-49599)

Learn more about PTMs related to PEX12 Antibody (NBP2-49599).

Blogs on PEX12

There are no specific blogs for PEX12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX12