Home » PEX7 » PEX7 Antibodies » PEX7 Antibody

PEX7 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PEX7 Antibody Summary

Immunogen
Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PEX7 and was validated on Western blot.
Publications
Read Publication using
NBP1-57578 in the following applications:

  • CoIP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEX7 Antibody

  • peroxin-7
  • peroxisomal biogenesis factor 7
  • peroxisomal targeting signal 2 receptor
  • peroxisome targeting signal 2 receptor
  • PTS2 receptor
  • PTS2Rperoxisomal PTS2 receptor
  • RCDP1
  • RD

Background

PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
RB1 Antibody
(172C1094) - (cleaved
NB100-56598
Knockdown Validated: RB1 Antibody (172C1094) - (cleaved) [NB100-56598] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and RB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human RB-1 Monoclonal Antibody (Catalog # NB100-56598) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for RB-1 at approximately 60 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Regucalcin Antibody
NBP1-80849
Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human adrenal gland, kidney, liver and tonsil using Anti-RGN antibody NBP1-80849 (A) shows similar protein distribution across tissues to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Analysis in human adrenal gland and tonsil tissues using NBP1-80849 antibody. Corresponding RGN RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NNT Antibody
NBP1-32109
Immunocytochemistry/Immunofluorescence: NNT Antibody [NBP1-32109] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NNT protein stained by NNT antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: NNT Antibody [NBP1-32109] - Rat tissue extract (50 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with NNT antibody diluted at 1:1000.
Western Blot: NNT Antibody [NBP1-32109] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NNT antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PEX5 Antibody
NBP1-87185
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human lymph node using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex using Anti-PEX5 antibody.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - miRNA-768-3p specifically targets K-ras. Effect of miRNA inhibitors that were reduced by co-culture on the level of pan-RAS, phospho-B-Raf and CD44 and pan-Akt by western blotting. Also shown is the effect of different miRNA inhibitors on the level of K-ras in H520 cells by western blot. Cropped blots are shown and were run under the same experimental conditions. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep02392), licensed under a CC-BY licence.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Nucleostemin
Antibody [Unconjugate
AF1638
Nucleostemin was detected in immersion fixed U2OS human osteosarcoma cell line using 10 µg/mL Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Nucleostemin at approximately 83 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC‑3 human prostate cancer cell line and SW480 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nucleostemin at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and cells in granular and molecular layer.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Frataxin antibody, and then analyzed by flow cytometry.
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
CDAN1 Antibody
NBP2-38473
Immunocytochemistry/Immunofluorescence: CDAN1 Antibody [NBP2-38473] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Western Blot: CDAN1 Antibody [NBP2-38473] - Analysis in control (vector only transfected HEK293T lysate) and CDAN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - Analysis of Hela cells, using anti-RanGAP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - Analysis of Jurkat cells, using anti-RanGAP1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: RanGAP1 Antibody (1B4) [NBP2-02623] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RanGAP1 antibody, and then analyzed by flow cytometry.
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PEX14 Antibody
NBP2-33455
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human liver shows moderate cytoplasmic granular positivity in hepatocytes.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
IL-6 [HRP]
D6050
(32 Reviews)
(605 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
PEX7 Antibody
NBP1-57578
PEX7 Antibody
Species: Hu
Applications: WB

Publications for PEX7 Antibody (NBP1-57578)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: CoIP, WB.


Filter By Application
CoIP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PEX7 Antibody (NBP1-57578) (0)

There are no reviews for PEX7 Antibody (NBP1-57578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX7 Antibody (NBP1-57578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX7 Products

Array NBP1-57578

Bioinformatics Tool for PEX7 Antibody (NBP1-57578)

Discover related pathways, diseases and genes to PEX7 Antibody (NBP1-57578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX7 Antibody (NBP1-57578)

Discover more about diseases related to PEX7 Antibody (NBP1-57578).
 

Pathways for PEX7 Antibody (NBP1-57578)

View related products by pathway.

PTMs for PEX7 Antibody (NBP1-57578)

Learn more about PTMs related to PEX7 Antibody (NBP1-57578).
 

Research Areas for PEX7 Antibody (NBP1-57578)

Find related products by research area.

Blogs on PEX7

There are no specific blogs for PEX7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PEX7
Uniprot