Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7.
Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PEX7 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Publication using NBP1-57578 | Applications | Species |
---|---|---|
Salcher S, Hagenbuchner J, Geiger K et al. C10ORF10/DEPP, a transcriptional target of FOXO3, regulates ROS-sensitivity in human neuroblastoma. Mol. Cancer. 2014-10-14 [PMID: 25261981] (Co-Immunoprecipitation, WB, Human) | Co-Immunoprecipitation, WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for PEX7 Antibody (NBP1-57578)Discover more about diseases related to PEX7 Antibody (NBP1-57578).
| Pathways for PEX7 Antibody (NBP1-57578)View related products by pathway.
|
PTMs for PEX7 Antibody (NBP1-57578)Learn more about PTMs related to PEX7 Antibody (NBP1-57578).
| Research Areas for PEX7 Antibody (NBP1-57578)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.