PEX7 Antibody


Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Hu, Mu, Rt, Bv, Ca, Gp, RbSpecies Glossary
Applications WB

Order Details

PEX7 Antibody Summary

Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI.
Predicted Species
Human (100%), Mouse (100%), Rat (100%), Canine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PEX7 and was validated on Western blot.
PEX7 Knockout 293T Cell Lysate
Read Publication using
NBP1-57578 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEX7 Antibody

  • peroxin-7
  • peroxisomal biogenesis factor 7
  • peroxisomal targeting signal 2 receptor
  • peroxisome targeting signal 2 receptor
  • PTS2 receptor
  • PTS2Rperoxisomal PTS2 receptor
  • RCDP1
  • RD


PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Hu, Mu, Rt, Bv, Ca, Gp, Rb
Applications: WB

Publications for PEX7 Antibody (NBP1-57578)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: CoIP, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PEX7 Antibody (NBP1-57578) (0)

There are no reviews for PEX7 Antibody (NBP1-57578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX7 Antibody (NBP1-57578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PEX7 Products

Array NBP1-57578

Bioinformatics Tool for PEX7 Antibody (NBP1-57578)

Discover related pathways, diseases and genes to PEX7 Antibody (NBP1-57578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX7 Antibody (NBP1-57578)

Discover more about diseases related to PEX7 Antibody (NBP1-57578).

Pathways for PEX7 Antibody (NBP1-57578)

View related products by pathway.

PTMs for PEX7 Antibody (NBP1-57578)

Learn more about PTMs related to PEX7 Antibody (NBP1-57578).

Blogs on PEX7

There are no specific blogs for PEX7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PEX7 Antibody and receive a gift card or discount.


Gene Symbol PEX7