Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7.
Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PEX7 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against PEX7 and was validated on Western blot. |
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-57578 | Applications | Species |
---|---|---|
Salcher S, Hagenbuchner J, Geiger K et al. C10ORF10/DEPP, a transcriptional target of FOXO3, regulates ROS-sensitivity in human neuroblastoma. Mol. Cancer. 2014 Oct 14 [PMID: 25261981] (WB, CoIP, Human) | WB, CoIP | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for PEX7 Antibody (NBP1-57578)Discover more about diseases related to PEX7 Antibody (NBP1-57578).
| Pathways for PEX7 Antibody (NBP1-57578)View related products by pathway.
|
PTMs for PEX7 Antibody (NBP1-57578)Learn more about PTMs related to PEX7 Antibody (NBP1-57578).
| Research Areas for PEX7 Antibody (NBP1-57578)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.