Home » PEX7 » PEX7 Antibodies » PEX7 Antibody

PEX7 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PEX7 Antibody Summary

Immunogen
Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PEX7 and was validated on Western blot.
Control
PEX7 Lysate (NBP2-65021)
Publications
Read Publication using
NBP1-57578 in the following applications:

  • CoIP
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEX7 Antibody

  • Peroxin-7
  • peroxisomal biogenesis factor 7
  • peroxisomal targeting signal 2 receptor
  • peroxisome targeting signal 2 receptor
  • PTS2 receptor
  • PTS2Rperoxisomal PTS2 receptor
  • RCDP1
  • RD

Background

PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
RB1 Antibody
NB100-56888
Western Blot: RB1 Antibody [NB100-56888] - Analysis of Retinoblastoma 1 in 30 ugs of Jurkat cell lysate using NB100-56888 at 1:1000 dilution.
(2 Reviews)
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Regucalcin Antibody
NBP1-80849
Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).
Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney.
Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NNT Antibody
NBP1-32109
Western Blot: NNT Antibody [NBP1-32109] - Rat tissue extract (50 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with NNT antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NNT Antibody [NBP1-32109] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NNT protein stained by NNT antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: NNT Antibody [NBP1-32109] - Paraffin-embedded mouse kidney dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PEX5 Antibody
NBP1-87185
Western Blot: PEX5 Antibody [NBP1-87185] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: PEX5 Antibody [NBP1-87185] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP1-87185] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP1-87185 (A) shows similar protein distribution across tissues to independent antibody NBP2-38443 (B).
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - KRAS monoclonal antibody (M01), clone 3B10-2F2 Analysis of KRAS expression in HeLa.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(10 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Nucleostemin
Antibody [Unconjugate
AF1638
Nucleostemin was detected in immersion fixed U2OS human osteosarcoma cell line using 10 µg/mL Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of PC‑3 human prostate cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for Nucleostemin at approximately 83 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC‑3 human prostate cancer cell line and SW480 human colorectal adenocarcinoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human/Mouse/Rat Nucleostemin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1638) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Nucleostemin at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
p130 Antibody
NBP1-82455
Western Blot: p130 Antibody [NBP1-82455] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: p130 Antibody [NBP1-82455] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p130 Antibody [NBP1-82455] - Staining of human kidney shows nuclear positivity both in tubules and in glomeruli.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FACA/FANCA Antibody
NB100-2564
Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.
(1 Publication)
Species: Hu
Applications: WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.
Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.
Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
CDAN1 Antibody
NBP2-38473
Western Blot: CDAN1 Antibody [NBP2-38473] - Analysis in control (vector only transfected HEK293T lysate) and CDAN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: CDAN1 Antibody [NBP2-38473] - Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: CDAN1 Antibody [NBP2-38473] - Staining in human endometrium and liver tissues using anti-CDAN1 antibody. Corresponding CDAN1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(527 Publications)
Species: Hu
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Western Blot: RanGAP1 Antibody (1B4) [NBP2-02623] Analysis of extracts (35ug) from 9 different cell lines by using anti-RanGAP1 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: RanGAP1 Antibody (1B4) [NBP2-02623] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY RanGAP1.
Immunohistochemistry-Paraffin: RanGAP1 Antibody (1B4) [NBP2-02623] - Staining of paraffin-embedded Human prostate tissue using anti-RanGAP1 mouse monoclonal antibody.
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PEX14 Antibody
NBP2-33455
Immunocytochemistry/Immunofluorescence: PEX14 Antibody [NBP2-33455] - Staining of human cell line U-2 OS shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX14 Antibody [NBP2-33455] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
Recombinant Human
PRH2 Protein
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
PEX7 Antibody
NBP1-57578
PEX7 Antibody
Species: Hu
Applications: WB

Publications for PEX7 Antibody (NBP1-57578)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: CoIP, WB.


Filter By Application
CoIP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PEX7 Antibody (NBP1-57578) (0)

There are no reviews for PEX7 Antibody (NBP1-57578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX7 Antibody (NBP1-57578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

PEX7 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PEX7 Antibody (NBP1-57578)

Discover related pathways, diseases and genes to PEX7 Antibody (NBP1-57578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX7 Antibody (NBP1-57578)

Discover more about diseases related to PEX7 Antibody (NBP1-57578).
 

Pathways for PEX7 Antibody (NBP1-57578)

View related products by pathway.

PTMs for PEX7 Antibody (NBP1-57578)

Learn more about PTMs related to PEX7 Antibody (NBP1-57578).

Blogs on PEX7

There are no specific blogs for PEX7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PEX7
Uniprot