PDZK1 Antibody

Images

 
Western Blot: PDZK1 Antibody [NBP1-82572] - Western blot analysis in mouse liver tissue and rat liver tissue.
Immunocytochemistry/ Immunofluorescence: PDZK1 Antibody [NBP1-82572] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: PDZK1 Antibody [NBP1-82572] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: PDZK1 Antibody [NBP1-82572] - Analysis in human kidney tissue.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDZK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDZK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
PDZK1 Protein (NBP1-82572PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDZK1 Antibody

  • CAP70
  • CFTR-associated protein of 70 kDa
  • CLAMP
  • Na(+)/H(+) exchanger regulatory factor 3
  • Na/Pi cotransporter C-terminal-associated protein 1
  • NaPi-Cap1
  • NHERF3
  • NHERF-3
  • NHERF3PDZD1Na(+)/H(+) exchange regulatory cofactor NHE-RF3
  • PDZ domain containing 1
  • PDZ domain-containing protein 1
  • PDZ-containing kidney protein 1
  • PDZD1
  • PDZK1
  • Sodium-hydrogen exchanger regulatory factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB400-151
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB
NB400-150
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, IHC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP2-35213
Species: Hu
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP2-42216
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for PDZK1 Antibody (NBP1-82572) (0)

There are no publications for PDZK1 Antibody (NBP1-82572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDZK1 Antibody (NBP1-82572) (0)

There are no reviews for PDZK1 Antibody (NBP1-82572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDZK1 Antibody (NBP1-82572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDZK1 Products

Bioinformatics Tool for PDZK1 Antibody (NBP1-82572)

Discover related pathways, diseases and genes to PDZK1 Antibody (NBP1-82572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDZK1 Antibody (NBP1-82572)

Discover more about diseases related to PDZK1 Antibody (NBP1-82572).
 

Pathways for PDZK1 Antibody (NBP1-82572)

View related products by pathway.

PTMs for PDZK1 Antibody (NBP1-82572)

Learn more about PTMs related to PDZK1 Antibody (NBP1-82572).
 

Research Areas for PDZK1 Antibody (NBP1-82572)

Find related products by research area.

Blogs on PDZK1

There are no specific blogs for PDZK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDZK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZK1
Entrez