PDX-1/IPF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PDX-1/IPF1 Antibody [NBP2-38865] - Staining of human cell line HeLa shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDX-1/IPF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDX-1/IPF1 Antibody - BSA Free (NBP2-38865) is a polyclonal antibody validated for use in ICC/IF. Anti-PDX-1/IPF1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PDX-1/IPF1 Protein (NBP2-38865PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDX-1/IPF1 Antibody - BSA Free

• Glucose-sensitive factor
• IDX1
• IDX-1GSF
• Insulin promoter factor 1
• insulin promoter factor 1, homeodomain transcription factor
• Insulin upstream factor 1
• IPF1
• IPF1pancreas/duodenum homeobox protein 1
• Islet/duodenum homeobox-1
• MODY4IUF1
• pancreatic and duodenal homeobox 1
• pancreatic-duodenal homeobox factor 1
• PDX-1
• PDX-1IPF-1
• somatostatin transcription factor 1
• Somatostatin-transactivating factor 1
• STF-1IUF-1

Background

PDX1 (Pancrease/duodenum homeobox 1, Insulin promoter factor 1, IPF1, Islet/duodenum homeobox 1, IDX1, Somatatostatin transactivating factor 1, STF1, Insulin upstream factor 1, UUF1, Glucose-sensitive factor, GSF) activates transcription of the insulin and somatostain genes. PDX1 is required for maintaining the hormone-producing phenotype of the beta-cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDX-1/IPF1 Antibody (NBP2-38865)(2)

Publications using NBP2-38865

• Lam CJ, Chatterjee A, Shen E et al. Low Level Insulin Content Within Abundant Non-Beta Islet Endocrine Cells in Long-Standing Type 1 Diabetes Diabetes 2018-12-14 [PMID: 30552110] (IF/IHC, Human)
• Lam CJ, Cox AR, Jacobson DR et al. Highly Proliferative alpha-Cell-Related Islet Endocrine Cells in Human Pancreata. Diabetes 2018-04-01 [PMID: 29326366]

Bioinformatics

• Gene Symbol: PDX1
• Uniprot:
  • P52945()