Orthogonal Strategies: Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney and lymph node tissues. Corresponding HNF1B RNA-seq data are presented for the same tissues.
Western Blot: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney tissue.
Immunocytochemistry/ Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Nuclear expression of HNF1B (green) in a subset of PDX1 expressing cells (blue) in human pancreas. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human kidney shows moderate to strong nuclear positivity in renal tubules.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human lymph node shows no positivity in lymphoid cells as expected.
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Simple Western lane view shows a specific band for HNF1B in 0.2 mg/ml of A549 lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Electropherogram image(s) of corresponding Simple Western lane view. TCF-2/HNF-1 beta antibody was used at 1:30 dilution on A549 lysate(s).
This antibody was developed against Recombinant Protein corresponding to amino acids: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNF1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in A549, separated by Size, antibody dilution of 1:30, apparent MW was 66 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
TCF2 encodes transcription factor 2, a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The TCF2 protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1; depending on the TCF2 isoform, the result may be to activate or inhibit transcription of target genes. Mutation of TCF2 that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). A third human transcript variant is believed to exist based on such a variant in the rat: however, to date such an mRNA species has not been isolated.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.