TCF-2/HNF-1 beta Antibody

Images

 
Western Blot: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney tissue.
Immunocytochemistry/ Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in renal tubules.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Immunohistochemical staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Immunohistochemical staining of human renal cancer shows moderate to strong nuclear positivity in tumor cells.
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Simple Western lane view shows a specific band for HNF1B in 0.2 mg/ml of A549 lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Electropherogram image(s) of corresponding Simple Western lane view. TCF-2/HNF-1 beta antibody was used at 1:30 dilution on A549 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF-2/HNF-1 beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNF1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
TCF-2/HNF-1 beta Protein (NBP1-89680PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89680 in the following applications:

Publications
Read Publications using
NBP1-89680 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24058607)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCF-2/HNF-1 beta Antibody

  • FJHN
  • hepatocyte nuclear factor 1-beta
  • HNF1 beta A
  • HNF-1 beta
  • HNF1 homeobox B
  • HNF1B
  • HNF-1B
  • HNF1beta
  • HNF-1-beta
  • HNF2
  • Homeoprotein LFB3
  • LFB3
  • LF-B3
  • MODY5
  • MODY5HPC11
  • TCF2
  • TCF-2
  • TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • Transcription factor 2
  • transcription factor 2, hepatic
  • Variant hepatic nuclear factor 1
  • VHNF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4186
Species: Hu
Applications: WB, ICC
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5596
Species: Hu
Applications: WB, IHC, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-89680
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for TCF-2/HNF-1 beta Antibody (NBP1-89680)(4)

Review for TCF-2/HNF-1 beta Antibody (NBP1-89680) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP1-89680:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta NBP1-89680
Enlarge
reviewed by:
Anonymous
IHC-P Human 09/25/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman fetal pancreas
SpeciesHuman
LotJ89927

Blocking

Blocking DetailsBSA 2%

Primary Anitbody

Dilution Ratio1/200, 1 hour incubation at room temperature.

Secondary Antibody

Secondary Descriptionanti-rabbit Alexa fluor 488
Secondary Concentration1/500 dilution of stock solution

Details

Fixation DetailsNeutral formalin fixed and paraffin-embedded. Performed antigen retrieval with low pH (citrate buffer) before blocking.
Wash DescriptionRegular PBS

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF-2/HNF-1 beta Antibody (NBP1-89680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF-2/HNF-1 beta Products

Bioinformatics Tool for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Discover related pathways, diseases and genes to TCF-2/HNF-1 beta Antibody (NBP1-89680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Discover more about diseases related to TCF-2/HNF-1 beta Antibody (NBP1-89680).
 

Pathways for TCF-2/HNF-1 beta Antibody (NBP1-89680)

View related products by pathway.

PTMs for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Learn more about PTMs related to TCF-2/HNF-1 beta Antibody (NBP1-89680).
 

Research Areas for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Find related products by research area.

Blogs on TCF-2/HNF-1 beta

There are no specific blogs for TCF-2/HNF-1 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/25/2014
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol HNF1B
Entrez
Uniprot