TCF-2/HNF-1 beta Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney and lymph node tissues. Corresponding HNF1B RNA-seq data are presented for the same tissues.
Western Blot: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Analysis in human kidney tissue.
Immunocytochemistry/ Immunofluorescence: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Nuclear expression of HNF1B (green) in a subset of PDX1 expressing cells (blue) in human pancreas. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human kidney shows moderate to strong nuclear positivity in renal tubules.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Staining of human lymph node shows no positivity in lymphoid cells as expected.
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Simple Western lane view shows a specific band for HNF1B in 0.2 mg/ml of A549 lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TCF-2/HNF-1 beta Antibody [NBP1-89680] - Electropherogram image(s) of corresponding Simple Western lane view. TCF-2/HNF-1 beta antibody was used at 1:30 dilution on A549 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TCF-2/HNF-1 beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNF1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP)
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. TCF-2/HNF-1 beta antibody validated for IHC-P from a verified customer review. Use in ChIP reported in scientific literature (PMID:32008054).
Control Peptide
TCF-2/HNF-1 beta Protein (NBP1-89680PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89680 in the following applications:

Publications
Read Publications using
NBP1-89680 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24058607). Use in Mouse reported in scientific literature (PMID:32008054).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCF-2/HNF-1 beta Antibody

  • FJHN
  • hepatocyte nuclear factor 1-beta
  • HNF1 beta A
  • HNF-1 beta
  • HNF1 homeobox B
  • HNF1B
  • HNF-1B
  • HNF1beta
  • HNF-1-beta
  • HNF2
  • Homeoprotein LFB3
  • LFB3
  • LF-B3
  • MODY5
  • MODY5HPC11
  • TCF2
  • TCF-2
  • TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor
  • Transcription factor 2
  • transcription factor 2, hepatic
  • Variant hepatic nuclear factor 1
  • VHNF1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4186
Species: Hu
Applications: ICC, WB
NBP2-27079
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF2419
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB5175
Species: Mu
Applications: IHC, WB
NBP2-93878
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5596
Species: Hu
Applications: ICC, IHC, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP1-89680
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP

Publications for TCF-2/HNF-1 beta Antibody (NBP1-89680)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ChIP, ICC/IF, IHC.


Filter By Application
ChIP
(1)
ICC/IF
(1)
IHC
(3)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species

Review for TCF-2/HNF-1 beta Antibody (NBP1-89680) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-89680:
Filter by Applications
Immunohistochemistry-Paraffin
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin TCF-2/HNF-1 beta NBP1-89680
Enlarge
5
reviewed by:
Valentina Villani
Immunohistochemistry-Paraffin Human 09/25/2014
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman fetal pancreas
SpeciesHuman
LotJ89927

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF-2/HNF-1 beta Antibody (NBP1-89680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF-2/HNF-1 beta Products

Bioinformatics Tool for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Discover related pathways, diseases and genes to TCF-2/HNF-1 beta Antibody (NBP1-89680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Discover more about diseases related to TCF-2/HNF-1 beta Antibody (NBP1-89680).
 

Pathways for TCF-2/HNF-1 beta Antibody (NBP1-89680)

View related products by pathway.

PTMs for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Learn more about PTMs related to TCF-2/HNF-1 beta Antibody (NBP1-89680).
 

Research Areas for TCF-2/HNF-1 beta Antibody (NBP1-89680)

Find related products by research area.

Blogs on TCF-2/HNF-1 beta

There are no specific blogs for TCF-2/HNF-1 beta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Valentina Villani
09/25/2014
Application: Immunohistochemistry-Paraffin
Species: Human

Bioinformatics

Gene Symbol HNF1B
Entrez
Uniprot