Home » PDGFR alpha » PDGFR alpha Antibodies » PDGFR alpha Antibody

PDGFR alpha Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PDGF R alpha Antibody [NBP2-76508] - Staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: PDGF R alpha Antibody [NBP2-76508] - Staining of human cell line CACO-2 shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Flow, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDGFR alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDGFRA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Use in Flow reported in scientific literature (PMID:35320046) Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100..
Publications
Read Publication using
NBP2-76508 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PDGFR alpha Antibody

  • alpha-type platelet-derived growth factor receptor
  • CD140 antigen-like family member A
  • CD140a antigen
  • CD140a
  • EC 2.7.10
  • EC 2.7.10.1
  • MGC74795
  • PDGF R alpha
  • PDGFR alpha
  • PDGFR2
  • PDGFRA
  • PDGFRA/BCR fusion
  • PDGF-R-alpha
  • platelet-derived growth factor receptor, alpha polypeptide
  • rearranged-in-hypereosinophilia-platelet derived growth factor receptor alphafusion protein
  • RHEPDGFRA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
Western blot shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line, and MC/9‑2 mouse mast cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for CD117/c-kit at approximately 135, 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CD117/c-kit was detected in immersion fixed frozen sections of mouse embryo using Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(12 Reviews)
(50 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
PDGF R beta
Antibody [Unconjugate
AF1042
PDGF R beta was detected in immersion fixed frozen sections of mouse embryo spinal cord using 5 µg/mL Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of rat spinal cord tissue, rat brain tissue, and mouse brain tissue. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse PDGF R beta Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1042) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for PDGF R beta at approximately 190 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(44 Publications)
Species: Mu
Applications: IHC, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
CD34 Antibody (MEC
14.7)
NB600-1071
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(24 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PDGF-AA
[Unconjugated]
221-AA
Recombinant Human PDGF-AA 221-AA stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line in a dose-dependent manner. The ED50 for this effect is 50-200 ng/mL.
(5 Reviews)
(48 Publications)
Species: Hu
Applications: BA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
VEGFR2/KDR/Flk-1
Antibody [Unconjugate ...
AF644
Recombinant Mouse VEGFR2/KDR/Flk‑1 Fc Chimera (Catalog # 443-KD) inhibits Recombinant Mouse VEGF164 (Catalog # 493-MV) induced proliferation in HUVEC human umbilical vein endothelial cells in a dose-dependent manner (orange line). Inhibition of Recombinant Mouse VEGF164 (5 ng/mL) activity elicited by Recombinant Mouse VEGFR2/KDR/Flk‑1 Fc Chimera (50 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Mouse VEGFR2/KDR/Flk‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF644). The ND50 is typically 0.1‑0.3 µg/mL.
VEGFR2 was detected in acetone fixed cryosections of mouse kidney tissue using Goat Anti-Mouse VEGFR2/KDR/Flk-1 Polyclonal Antibody (Catalog # AF644) for 50 minutes at room temperature. Tissues were stained with rabbit anti-goat secondaryantibody and HRP polymer-conjugated anti-rabbit IgG followed by AEC+Substrate Chromogen (red) followed by counterstaining with hematoxylin (blue). Experiments were carried out and the image was provided by Dr. Grietje Molema, University Medical Center Groningen, The Netherlands.
VEGFR2/KDR/Flk‑1 was detected in immersion fixed frozen sections of mouse embryo (14 d.p.c.) using 15 µg/mL Goat Anti-Mouse VEGFR2/KDR/Flk‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF644) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to mesenchymal cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Reviews)
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC/CF
1 μg/lane of Recombinant Human SCF/c-kit Ligand was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 19 kDa.
Recombinant Human SCF/c-kit Ligand (Catalog # 255-SC/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 1-5 ng/mL.
(165 Publications)
Species: Hu
Applications: BA
FGFR1 Antibody
(M19B2) - BSA Free
NB600-1287
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis using the Alexa Fluor 488 (R) conjugate of NB600-1287. Staining of FGF R1 in HEK293 and HEK293 FGFR transfected cells using anti-FGF R1 antibody. (Red) Positive cells, (Green) Negative cells, (Blue) Negative cells + antibody, (Pink) Positive cells + antibody. Image from verified customer review.
Flow Cytometry: FGF R1 Antibody (M19B2) [NB600-1287] - Intracellular flow cytometric staining of 1 x 10^6 HEK-293 cells using FGF R1 antibody (Dark Blue) and Isotype control (Orange). An antibody concentration of 1 ug/1x10^6 cells was used.
Western Blot: FGF R1 Antibody (M19B2) [NB600-1287] - Analysis of MCF7 (A), HepG2 (B), NIH3T3 (C), and PC-12 (D) cell lysate using FGF R1 antibody at 2 ug/ml.
(1 Review)
(7 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
DOG1/TMEM16A
Antibody (OTI1C8)
NBP2-46527
Immunohistochemistry: DOG1/TMEM16A Antibody (1C8) [NBP2-46527] - Analysis of Human skin tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: DOG1/TMEM16A Antibody (1C8) [NBP2-46527] - Analysis of Human adult heart tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: DOG1/TMEM16A Antibody (1C8) [NBP2-46527] - Analysis of Human adult brain tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
FIP1L1 Antibody
NBP1-85064
Immunocytochemistry/Immunofluorescence: FIP1L1 Antibody [NBP1-85064] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: FIP1L1 Antibody [NBP1-85064] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(28 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: IHC
VEGF [HRP]
DVE00
(26 Reviews)
(600 Publications)
Species: Hu
Applications: ELISA
PDGF-CC
1687-CC/CF
PDGF-CC
(12 Publications)
Species: Hu
Applications: BA
c-Abl Antibody
[Unconjugated]
AF5414
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, MCF‑7 human breast cancer cell line, and MDA‑MB‑453 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human c-Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Abl at approximately 135 - 145 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Abl at approximately 149 kDa (as indicated) using 10 µg/mL of Goat Anti-Human c‑Abl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5414) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for PDGFR alpha Antibody (NBP2-76508)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: Flow.


Filter By Application
Flow
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PDGFR alpha Antibody (NBP2-76508) (0)

There are no reviews for PDGFR alpha Antibody (NBP2-76508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDGFR alpha Antibody (NBP2-76508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDGFR alpha Products

Bioinformatics Tool for PDGFR alpha Antibody (NBP2-76508)

Discover related pathways, diseases and genes to PDGFR alpha Antibody (NBP2-76508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDGFR alpha Antibody (NBP2-76508)

Discover more about diseases related to PDGFR alpha Antibody (NBP2-76508).
 

Pathways for PDGFR alpha Antibody (NBP2-76508)

View related products by pathway.

PTMs for PDGFR alpha Antibody (NBP2-76508)

Learn more about PTMs related to PDGFR alpha Antibody (NBP2-76508).
 

Research Areas for PDGFR alpha Antibody (NBP2-76508)

Find related products by research area.

Blogs on PDGFR alpha

There are no specific blogs for PDGFR alpha, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDGFR alpha Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PDGFRA