FIP1L1 Antibody

Images

 
Western Blot: FIP1L1 Antibody [NBP1-85064] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: FIP1L1 Antibody [NBP1-85064] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FIP1L1 Antibody [NBP1-85064] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Western Blot: FIP1L1 Antibody [NBP1-85064] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-219

Product Details

Summary
Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FIP1L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KANSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FIP1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FIP1L1 Protein (NBP1-85064PEP)
Publications
Read Publication using NBP1-85064.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FIP1L1 Antibody

  • DKFZp586K0717
  • EC 1.1.1.86
  • EC 4.2.1.33
  • Factor interacting with PAP
  • FIP1 like 1 (S. cerevisiae)
  • FIP1
  • FIP1-like 1 protein
  • FLJ33619
  • hFip1
  • pre-mRNA 3'-end-processing factor FIP1
  • Rearranged in hypereosinophilia
  • Rhe

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
AF5414
Species: Hu
Applications: WB, Simple Western
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF2988
Species: Mu, Rt
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32719
Species: Hu
Applications: WB, ICC/IF

Publications for FIP1L1 Antibody (NBP1-85064)(1)

Reviews for FIP1L1 Antibody (NBP1-85064) (0)

There are no reviews for FIP1L1 Antibody (NBP1-85064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FIP1L1 Antibody (NBP1-85064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FIP1L1 Products

Bioinformatics Tool for FIP1L1 Antibody (NBP1-85064)

Discover related pathways, diseases and genes to FIP1L1 Antibody (NBP1-85064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FIP1L1 Antibody (NBP1-85064)

Discover more about diseases related to FIP1L1 Antibody (NBP1-85064).
 

Pathways for FIP1L1 Antibody (NBP1-85064)

View related products by pathway.

PTMs for FIP1L1 Antibody (NBP1-85064)

Learn more about PTMs related to FIP1L1 Antibody (NBP1-85064).

Blogs on FIP1L1

There are no specific blogs for FIP1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FIP1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FIP1L1