Pax4 Antibody

Images

 
Western Blot: Pax4 Antibody [H00005078-D01P] - Analysis of PAX4 expression in transfected 293T cell line by PAX4 polyclonal antibody.Lane 1: PAX4 transfected lysate(37.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pax4 Antibody Summary

Immunogen
PAX4 (NP_006184.1, 1 a.a. - 343 a.a.) full-length human protein. MNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACLKPCWGHLPPQPNSLDSGLLCLPCPSSHCPLASLSGSQALLWPGCPLLYGLE
Specificity
PAX4 - paired box 4,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAX4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pax4 Antibody

  • KPD
  • MGC129960
  • MODY9paired box protein Pax-4
  • paired box 4
  • paired box gene 4
  • paired domain gene 4
  • Pax4

Background

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box 4 gene is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing beta cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF3444
Species: Hu
Applications: WB
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
AF2746
Species: Hu, Mu
Applications: WB, ICC
AF6014
Species: Hu, Mu, Rt
Applications: WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
AF7068
Species: Hu
Applications: WB, IHC, ICC
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
H00005078-D01P
Species: Hu
Applications: WB

Publications for Pax4 Antibody (H00005078-D01P) (0)

There are no publications for Pax4 Antibody (H00005078-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax4 Antibody (H00005078-D01P) (0)

There are no reviews for Pax4 Antibody (H00005078-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pax4 Antibody (H00005078-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pax4 Products

Bioinformatics Tool for Pax4 Antibody (H00005078-D01P)

Discover related pathways, diseases and genes to Pax4 Antibody (H00005078-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax4 Antibody (H00005078-D01P)

Discover more about diseases related to Pax4 Antibody (H00005078-D01P).
 

Pathways for Pax4 Antibody (H00005078-D01P)

View related products by pathway.

PTMs for Pax4 Antibody (H00005078-D01P)

Learn more about PTMs related to Pax4 Antibody (H00005078-D01P).

Blogs on Pax4.

Using EGF Protein from Novus Biologicals
EGF (epidermal growth factor) stimulates differentiation, proliferation and cell growth by binding to its receptor, EGFR. EGF was first discovered in the mouse submandibular gland in 1986 by Stanley Cohen of Vanderbilt University, leading to a Nobel P...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX4
Entrez
Uniprot