PARL Antibody

Western Blot: PARL Antibody [NBP1-80878] - Analysis in human cell line CACO-2 and human cell line HeLa.

Immunocytochemistry/Immunofluorescence: PARL Antibody [NBP1-80878] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: PARL Antibody [NBP1-80878] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PARL Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQR
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PARL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PARL Recombinant Protein Antigen (NBP1-80878PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PARL Antibody

• EC 3.4.21.105
• mitochondrial
• PARL
• presenilin associated, rhomboid-like
• PRO2207
• PSARL1
• RHBDS1
• rhomboid 7 homolog 1

Background

PARL encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PARL Antibody (NBP1-80878)(2)

Publications using NBP1-80878

• Gonciarz R, Jiang H, Hugelshofter C et al. In vivo Bioluminescence Imaging of Labile Iron in Xenograft Models and Liver Using FeAl-1, an Iron-Activatable Form of D-Luciferin SSRN Electronic Journal 2022-11-20
• Subramaniam, N, N The Contribution of LncRNAs to Tip-Stalk Patterning in the Vascular Endothelium Thesis 2022-01-01

Bioinformatics

• Gene Symbol: PARL
• Entrez:
  • 55486(Human)
• Uniprot:
  • Q9H300(Human)