YME1L1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: YME1L1 Antibody [NBP2-49499] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria.

Immunohistochemistry-Paraffin: YME1L1 Antibody [NBP2-49499] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

YME1L1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit YME1L1 Antibody - BSA Free (NBP2-49499) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YME1L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  YME1L1 Recombinant Protein Antigen (NBP2-49499PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for YME1L1 Antibody - BSA Free

• ATP-dependent metalloprotease FtsH1 homolog
• ATP-dependent metalloprotease FtsH1
• ATP-dependent metalloprotease YME1L1
• EC 3.4.24
• EC 3.4.24.-
• FTSH
• FTSH1
• MEG4
• Meg-4
• PAMPATP-dependent zinc metalloprotease YME1L1
• Presenilin-associated metalloprotease
• YME1 (S.cerevisiae)-like 1
• YME1-like 1 (S. cerevisiae)
• YME1-like protein 1
• YME1Lmeg-4

Background

The protein encoded by the YME1L1 gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YME1L1