p66 beta Antibody - BSA Free

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Analysis in human cerebral cortex and liver tissues using NBP1-87358 antibody. Corresponding GATAD2B RNA-seq data are presented for the same tissues.

Western Blot: p66 beta Antibody [NBP1-87358] - Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GATAD2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: p66 beta Antibody [NBP1-87358] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.

Western Blot: p66 beta Antibody [NBP1-87358] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Cerebellum shows strong nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Lymph node shows strong nuclear positivity in germinal and non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p66 beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATAD2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  p66 beta Protein (NBP1-87358PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p66 beta Antibody - BSA Free

• FLJ37346
• GATA zinc finger domain containing 2B
• GATA zinc finger domain-containing protein 2B
• KIAA1150
• MGC138257
• MGC138285
• p66/p68
• P66beta
• RP11-216N14.6
• transcription repressor p66 beta component of the MeCP1 complex
• transcriptional repressor p66-beta

Background

P66beta/GATAD2B interacts with MBD2 (methyl-CpG-binding domain 2) and MBD3 (methyl-CpG-binding domain 3) and participates in transcriptional repression in association with the MBD2/NuRD and MBD3/NuRD histone deacetylase complexes. P66beta/GATAD2B is SUMOylated in vivo and its repressive activity has been shown to be enhanced by SUMOylation. Alternate names for P66beta/GATAD2B include transcriptional repressor p66 beta, p66/p68, GATA zinc-finger domain-containing protein 2B, FLJ37346, and KIAA1150.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p66 beta Antibody (NBP1-87358)(1)

Publication using NBP1-87358

• Usui N, Araujo DJ, Kulkarni A et al. Foxp1 regulation of neonatal vocalizations via cortical development Genes Dev. 2017-10-15 [PMID: 29138280] (Mouse)

Bioinformatics

• Gene Symbol: GATAD2B
• Entrez:
  • 57459(Human)
• Uniprot:
  • Q8WXI9(Human)