p66 beta Antibody

Images

 
Western Blot: p66 beta Antibody [NBP1-87358] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: p66 beta Antibody [NBP1-87358] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human lymph node shows strong nuclear positivity in reaction center cells.
Western Blot: p66 beta Antibody [NBP1-87358] - Analysis in human cell line SH-SY5Y.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p66 beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATAD2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
p66 beta Protein (NBP1-87358PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p66 beta Antibody

  • FLJ37346
  • GATA zinc finger domain containing 2B
  • GATA zinc finger domain-containing protein 2B
  • KIAA1150
  • MGC138257
  • MGC138285
  • p66/p68
  • P66beta
  • RP11-216N14.6
  • transcription repressor p66 beta component of the MeCP1 complex
  • transcriptional repressor p66-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87359
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-56534
Species: Hu
Applications: WB, IHC-P, ICC
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55046
Species: Hu
Applications: WB
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-31316
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-56759
Species: Hu
Applications: ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87358
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for p66 beta Antibody (NBP1-87358) (0)

There are no publications for p66 beta Antibody (NBP1-87358).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p66 beta Antibody (NBP1-87358) (0)

There are no reviews for p66 beta Antibody (NBP1-87358). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p66 beta Antibody (NBP1-87358) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p66 beta Products

Bioinformatics Tool for p66 beta Antibody (NBP1-87358)

Discover related pathways, diseases and genes to p66 beta Antibody (NBP1-87358). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p66 beta Antibody (NBP1-87358)

Discover more about diseases related to p66 beta Antibody (NBP1-87358).
 

Pathways for p66 beta Antibody (NBP1-87358)

View related products by pathway.

Blogs on p66 beta

There are no specific blogs for p66 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p66 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD2B
Entrez
Uniprot