Home » POLD3 » POLD3 Antibodies » POLD3 Antibody (3E2)

POLD3 Antibody (3E2)

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: POLD3 Antibody (3E2) [H00010714-M01] - Analysis of monoclonal antibody to POLD3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: POLD3 Antibody (3E2) [H00010714-M01] - Analysis of monoclonal antibody to POLD3 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: POLD3 Antibody (3E2) [H00010714-M01] - Detection limit for recombinant GST tagged POLD3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

POLD3 Antibody (3E2) Summary

Immunogen
POLD3 (NP_006582, 357 a.a. ~ 467 a.a) partial recombinant protein with GST tag.PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGC IVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREER KGPKKGTAALGKANRQVSITGFFQRK
Specificity
POLD3 - polymerase (DNA-directed), delta 3, accessory subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Publications
Read Publications using
H00010714-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLD3 Antibody (3E2)

  • DNA polymerase delta subunit 3
  • DNA polymerase delta subunit p66
  • DNA polymerase delta, subunit 3
  • KIAA0039MGC119643
  • MGC119642
  • P66
  • P68
  • polymerase (DNA directed), delta 3
  • polymerase (DNA-directed), delta 3, accessory subunit

Background

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3, and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHC1 Antibody (3F4)
H00006464-M01
Western Blot: SHC1 Antibody (3F4) [H00006464-M01] - SHC1 monoclonal antibody (M01), clone 3F4 Analysis of SHC1 expression in A-431.
Immunocytochemistry/Immunofluorescence: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on A-431 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SHC1 Antibody (3F4) [H00006464-M01] - Analysis of monoclonal antibody to SHC1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
Species: Hu
Applications: WB, IHC, ICC
ZNF398 Antibody
NBP1-31317
Western Blot: ZNF398 Antibody [NBP1-31317] - Sample (30 ug of whole cell lysate) A: 293T B: H1299 7. 5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ZNF398 Antibody [NBP1-31317] - Analysis of HeLa, using ZNF398 antibody at 1:200 dilution.
Species: Hu, Rt
Applications: WB, ICC/IF
POMT1 Antibody
NBP1-60054
Western Blot: POMT1 Antibody [NBP1-60054] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
DDX17 Antibody
NB200-352
Western Blot: DDX17 Antibody [NB200-352] - Detection of Human DDX17 by Western Blot. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX17 antibody NB200-352 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Immunohistochemistry-Paraffin: DDX17 Antibody [NB200-352] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- DDX17 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: DDX17 Antibody [NB200-352] - Whole cell lysate (50 ug) from NIH3T3, TCMK1,4T1,CT26.WT, and rat C6 cells. Antibodies: Affinity purified rabbit anti-DDX17 antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(1 Publication)
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
DDX5 Antibody
NB200-351
Western Blot: DDX5 Antibody [NB200-351] - Detection of Human and Mouse DDX5 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-DDX5 antibody NB200-351 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Immunohistochemistry: DDX5 Antibody [NB200-351] - ~~ Sample: FFPE section of mouse renal cell carcinoma.~ Antibody: Affinity purified rabbit anti-DDX5 ~Cat. No. Lot2 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Western Blot: DDX5 Antibody [NB200-351] - Detection of DDX5 in whole cell lysates from HeLa (5, 15, 50 ug), 293 (T; 50 ug), and MCF7 (M; 50 ug), and K562 (K; 50 ug) for WB (A) and HeLa (1 mg) for IP (B). Antibodies: NB 200-351 used at 0.04 ug/ml for WB (A & B) and at 3 ug/ml lysate for IP (B). DDX5 was also immonuprecipitated with NB 200-350 used at 3 ug/ml lysate. Detection: ECL 30 seconds.
(1 Review)
(5 Publications)
Species: Hu, Mu, Ha
Applications: WB, IHC, IHC-P, IP
LEDGF Antibody
(762815)
MAB3468
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. Gels were loaded with 40 µg of cytoplasmic (Cyto) and 20 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for LEDGF p75 at approximately 75 kDa and LEDGF p52 at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
LEDGF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC
ERK2 Antibody
(SZ25-01)
NBP2-67360
Western Blot: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of ERK2 on different lysates using anti-ERK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: PC-12
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of paraffin-embedded mouse stomach tissue using anti-ERK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ARHGEF7 Antibody
NBP1-88650
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Species: Hu
Applications: WB, IHC, IHC-P
Annexin A6 Antibody
NBP1-90149
Western Blot: Annexin A6 Antibody [NBP1-90149] - Analysis in human cell lines SK-MEL-30 and A-431 using anti-ANXA6 antibody. Corresponding ANXA6 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunohistochemistry-Paraffin: Annexin A6 Antibody [NBP1-90149] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Annexin A6 Antibody [NBP1-90149] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NFkB2/NFkB p100
Antibody
NBP1-87760
Western Blot: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Analysis using Anti-NFKB2 antibody NBP1-87760 (A) shows similar pattern to independent antibody NBP1-87759 (B).
Immunocytochemistry/Immunofluorescence: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NFkB2/NFkB p100 Antibody [NBP1-87760] - NFkB p100/p52 Antibody [NBP1-87760] - Staining of human testis.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
FKBP52/FKBP4
Antibody
NBP1-84675
Western Blot: FKBP52/FKBP4 Antibody [NBP1-84675] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: FKBP52/FKBP4 Antibody [NBP1-84675] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody [NBP1-84675] - Staining in human testis and duodenum tissues using anti-FKBP4 antibody. Corresponding FKBP4 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TPPP/p25 Antibody
NBP2-34031
Western Blot: TPPP/p25 Antibody [NBP2-34031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral cortex tissue.
Immunocytochemistry/Immunofluorescence: TPPP/p25 Antibody [NBP2-34031] - Staining of human cell line A549 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Staining in human cerebral cortex and liver tissues using anti-TPPP antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
GTF2H4 Antibody
H00002968-B01P
Western Blot: GTF2H4 Antibody [H00002968-B01P] - Analysis of GTF2H4 expression in transfected 293T cell line by GTF2H4 polyclonal antibody. Lane 1: GTF2H4 transfected lysate(50.82 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GTF2H4 Antibody [H00002968-B01P] - Analysis of purified antibody to GTF2H4 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for POLD3 Antibody (H00010714-M01)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for POLD3 Antibody (H00010714-M01) (0)

There are no reviews for POLD3 Antibody (H00010714-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLD3 Antibody (H00010714-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional POLD3 Products

Bioinformatics Tool for POLD3 Antibody (H00010714-M01)

Discover related pathways, diseases and genes to POLD3 Antibody (H00010714-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLD3 Antibody (H00010714-M01)

Discover more about diseases related to POLD3 Antibody (H00010714-M01).
 

Pathways for POLD3 Antibody (H00010714-M01)

View related products by pathway.

PTMs for POLD3 Antibody (H00010714-M01)

Learn more about PTMs related to POLD3 Antibody (H00010714-M01).
 

Research Areas for POLD3 Antibody (H00010714-M01)

Find related products by research area.

Blogs on POLD3

There are no specific blogs for POLD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLD3 Antibody (3E2) and receive a gift card or discount.


Bioinformatics

Gene Symbol POLD3
Entrez
Uniprot