POLD3 Antibody (3E2) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: POLD3 Antibody (3E2) [H00010714-M01] - Analysis of monoclonal antibody to POLD3 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: POLD3 Antibody (3E2) [H00010714-M01] - Detection limit for recombinant GST tagged POLD3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3E2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

POLD3 Antibody (3E2) - Azide and BSA Free Summary

• Immunogen: POLD3 (NP_006582, 357 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
• Specificity: POLD3 - polymerase (DNA-directed), delta 3, accessory subunit
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: POLD3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Western Blot 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLD3 Antibody (3E2) - Azide and BSA Free

• DNA polymerase delta subunit 3
• DNA polymerase delta subunit p66
• DNA polymerase delta, subunit 3
• KIAA0039MGC119643
• MGC119642
• P66
• P68
• polymerase (DNA directed), delta 3
• polymerase (DNA-directed), delta 3, accessory subunit

Background

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3, and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POLD3 Antibody (H00010714-M01)(15)

Publications using H00010714-M01

• Lu R, Nelson CB, Rogers S et Al. Distinct modes of telomere synthesis and extension contribute to Alternative Lengthening of Telomeres iScience 2023-12-11 [PMID: 38213617]
• Rosso I, Jones-Weinert C, Rossiello F et al. Alternative lengthening of telomeres (ALT) cells viability is dependent on C-rich telomeric RNAs Nature communications 2023-11-04 [PMID: 37925537]
• Rose AM, Goncalves T, Cunniffe S et al. Induction of the alternative lengthening of telomeres pathway by trapping of proteins on DNA Nucleic acids research 2023-03-20 [PMID: 36940725] (WB, Human)
  
  Details:
  Dilution used in WB 1:500
• Madhura D, Theodore P, Nahed J et al. Error-prone repair of stalled replication forks drives mutagenesis and loss of heterozygosity in haploinsufficient BRCA1 cells. Mol Cell. 2022-09-07 [PMID: 36099913]
• Shixin C, John W, Nicole B et al. Cockayne syndrome group B protein uses its DNA translocase activity to promote mitotic DNA synthesis DNA Repair (Amst). 2022-06-17 [PMID: 35738143]
• Camelia M, Eleftheria K, Maria F et al. DNA replication is highly resilient and persistent under the challenge of mild replication stress. Cell Rep. 2022-04-19 [PMID: 35443178]
• Barroso-GonzAlez J, GarcIa-ExpOsito L, Galaviz P et al. Anti-recombination function of MutS alpha restricts telomere extension by ALT-associated homology-directed repair Cell reports 2021-12-07 [PMID: 34879271]
• Silva B, Arora R, Bione S, Azzalin CM. TERRA transcription destabilizes telomere integrity to initiate break-induced replication in human ALT cells Nature Communications 2021-06-18 [PMID: 34145295]
• Raghunandan M, Geelen D, Majerova E, Decottignies A NHP2 downregulation counteracts hTR-mediated activation of the DNA damage response at ALT telomeres The EMBO journal 2021-02-17 [PMID: 33595114]
• Zhang H, Zhao R, Tones J et al. Nuclear body phase separation drives telomere clustering in ALT cancer cells Mol. Biol. Cell 2020-06-24 [PMID: 32579423]
• Feng E, Batenburg N, Walker J et al. CSB cooperates with SMARCAL1 to maintain telomere stability in ALT cells. J Cell Sci. 2020-02-17 [PMID: 31974116]
• Silva B, Pentz R, Figueira AM et al. FANCM limits ALT activity by restricting telomeric replication stress induced by deregulated BLM and R-loops Nat Commun 2019-05-30 [PMID: 31138795] (WB, Human)
• Gao S, Feng S, Ning S et al. An OB-fold complex controls the repair pathways for DNA double-strand breaks. Nat Commun 2018-09-25 [PMID: 30254264]
• Minocherhomji S, Ying S, Bjerregaard VA et al. Replication stress activates DNA repair synthesis in mitosis. Nature 2015-12-02 [PMID: 26633632]
• Bursomanno S, Beli P, Khan AM et al. Proteome-wide analysis of SUMO2 targets in response to pathological DNA replication stress in human cells. DNA Repair (Amst). 2014-11-25 [PMID: 25497329]

Bioinformatics

• Gene Symbol: POLD3
• Entrez:
  • 10714(Human)
• Uniprot:
  • NP_006582(Human)