POLD3 Antibody (3E2)

Images

 
Immunocytochemistry/ Immunofluorescence: POLD3 Antibody (3E2) [H00010714-M01] - Analysis of monoclonal antibody to POLD3 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: POLD3 Antibody (3E2) [H00010714-M01] - Detection limit for recombinant GST tagged POLD3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLD3 Antibody (3E2) Summary

Immunogen
POLD3 (NP_006582, 357 a.a. ~ 467 a.a) partial recombinant protein with GST tag.PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGC IVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREER KGPKKGTAALGKANRQVSITGFFQRK
Specificity
POLD3 - polymerase (DNA-directed), delta 3, accessory subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It is also useful for immunofluorescence.
Publications
Read Publications using H00010714-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLD3 Antibody (3E2)

  • DNA polymerase delta subunit 3
  • DNA polymerase delta subunit p66
  • DNA polymerase delta, subunit 3
  • KIAA0039MGC119643
  • MGC119642
  • P66
  • P68
  • polymerase (DNA directed), delta 3
  • polymerase (DNA-directed), delta 3, accessory subunit

Background

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3, and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-31317
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-57200
Species: Hu
Applications: ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB110-40561
Species: Hu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84675
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for POLD3 Antibody (H00010714-M01)(2)

Reviews for POLD3 Antibody (H00010714-M01) (0)

There are no reviews for POLD3 Antibody (H00010714-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLD3 Antibody (H00010714-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for POLD3 Antibody (H00010714-M01)

Discover related pathways, diseases and genes to POLD3 Antibody (H00010714-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLD3 Antibody (H00010714-M01)

Discover more about diseases related to POLD3 Antibody (H00010714-M01).
 

Pathways for POLD3 Antibody (H00010714-M01)

View related products by pathway.

PTMs for POLD3 Antibody (H00010714-M01)

Learn more about PTMs related to POLD3 Antibody (H00010714-M01).
 

Research Areas for POLD3 Antibody (H00010714-M01)

Find related products by research area.

Blogs on POLD3

There are no specific blogs for POLD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLD3 Antibody (3E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLD3
Entrez
Uniprot