p66 alpha Antibody

Images

 
Western Blot: p66 alpha Antibody [NBP1-87359] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: p66 alpha Antibody [NBP1-87359] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p66 alpha Antibody [NBP1-87359] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Western Blot: p66 alpha Antibody [NBP1-87359] - Analysis in human cell line K562.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

p66 alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATAD2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Theoretical MW
68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
p66 alpha Protein (NBP1-87359PEP)
Publications
Read Publication using
NBP1-87359 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25190814).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for p66 alpha Antibody

  • FLJ20085
  • FLJ21017
  • GATA zinc finger domain containing 2A
  • GATA zinc finger domain-containing protein 2A
  • hp66alpha
  • p66 alpha
  • p66alpha
  • transcriptional repressor p66-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87358
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NB100-56534
Species: Hu
Applications: WB, IHC-P, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-93469
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP2-13734
Species: Hu
Applications: IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE

Publications for p66 alpha Antibody (NBP1-87359)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for p66 alpha Antibody (NBP1-87359) (0)

There are no reviews for p66 alpha Antibody (NBP1-87359). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p66 alpha Antibody (NBP1-87359) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p66 alpha Products

Bioinformatics Tool for p66 alpha Antibody (NBP1-87359)

Discover related pathways, diseases and genes to p66 alpha Antibody (NBP1-87359). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p66 alpha Antibody (NBP1-87359)

Discover more about diseases related to p66 alpha Antibody (NBP1-87359).
 

Pathways for p66 alpha Antibody (NBP1-87359)

View related products by pathway.

Blogs on p66 alpha

There are no specific blogs for p66 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p66 alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GATAD2A
Entrez
Uniprot