p66 alpha Antibody - BSA Free

Immunohistochemistry-Paraffin: p66 alpha Antibody [NBP1-87359] - Staining of human colon, placenta, skeletal muscle and testis using Anti-p66 alpha antibody NBP1-87359 (A) shows similar protein distribution across tissues to independent antibody NBP1-87360 (B).

Western Blot: p66 alpha Antibody [NBP1-87359] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: p66 alpha Antibody [NBP1-87359] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Western Blot: p66 alpha Antibody [NBP1-87359] - Analysis in human cell line K562.

Immunohistochemistry-Paraffin: p66 alpha Antibody [NBP1-87359] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: p66 alpha Antibody [NBP1-87359] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

Immunohistochemistry-Paraffin: p66 alpha Antibody [NBP1-87359] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: p66 alpha Antibody [NBP1-87359] - Staining of human placenta shows trong nuclear positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

p66 alpha Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATAD2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IP, WB reported in scientific literature (PMID: 25190814). Use in CHIP reported in scientific literature (PMID:31934863). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Theoretical MW: 68 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  p66 alpha Protein (NBP1-87359PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25190814).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p66 alpha Antibody - BSA Free

• FLJ20085
• FLJ21017
• GATA zinc finger domain containing 2A
• GATA zinc finger domain-containing protein 2A
• hp66alpha
• p66 alpha
• p66alpha
• transcriptional repressor p66-alpha

Background

Methylation of cytosine at CpG dinucleotides is a common feature of many higher eukaryotic genomes (1-3). Increasing evidence indicates that recruitement of histone deacetylase complexes by methyl-CpG-binding proteins (MeCP) is a major mechanism of methylated DNA silencing. P66, a zinc finger-containing protein is one of the components of the MeCP1 complex (4). P66 and p68, the two components of MeCP1 are different forms of the same zinc finger-containing protein and are conserved from C.elegans to humans. Homologs of p66 from different organisms revealed two highly conserved regions, CR1 and CR2. While CR1 is involved in the association of p66 with other MeCP1 components, CR2 plays an important role in targeting p66 and MBD3 to specific loci (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p66 alpha Antibody (NBP1-87359)(2)

Publications using NBP1-87359

• Porreca RM, Herrera-Moyano E, Skourti E et al. TRF1 averts chromatin remodelling, recombination and replication dependent-break induced replication at mouse telomeres Elife 2020-01-14 [PMID: 31934863] (Chemotaxis, Mouse)
• Nishibuchi G, Shibata Y, Hayakawa T et al. Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex. J Biol Chem 2014-09-04 [PMID: 25190814] (IP, WB, Human)

Bioinformatics

• Gene Symbol: GATAD2A
• Entrez:
  • 54815(Human)
• Uniprot:
  • Q86YP4(Human)