FAM5B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM5B Antibody [NBP2-56759] - Staining of human cell line PC-3 shows localization to nucleoli & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM5B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQALLKRLPDDRFLNSTAISQFW
Specificity
Specificity of human FAM5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM5B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM5B Recombinant Protein Antigen (NBP2-56759PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FAM5B Antibody

  • BMP/retinoic acid-inducible neural-specific protein 2
  • BRINP2FLJ41342
  • DBCCR1L2RP5-1026E2.1
  • DBCCR1-like protein 2
  • DBCCR1-like2
  • family with sequence similarity 5, member B
  • KIAA1747

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85304
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31581
Species: Hu
Applications: IHC, IHC-P
NBP1-55046
Species: Hu
Applications: WB
NLS3208
Species: Hu, Po, Bv, Eq, Pm, Pm
Applications: WB, IHC, IHC-P, ICC
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83450
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-40848
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, KD
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, ChIP, KD, Single-Cell Western
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1207
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-93275
Species: Hu, Mu
Applications: WB
NBP2-56759
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for FAM5B Antibody (NBP2-56759) (0)

There are no publications for FAM5B Antibody (NBP2-56759).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM5B Antibody (NBP2-56759) (0)

There are no reviews for FAM5B Antibody (NBP2-56759). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM5B Antibody (NBP2-56759) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM5B Products

Bioinformatics Tool for FAM5B Antibody (NBP2-56759)

Discover related pathways, diseases and genes to FAM5B Antibody (NBP2-56759). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM5B Antibody (NBP2-56759)

Discover more about diseases related to FAM5B Antibody (NBP2-56759).

Blogs on FAM5B

There are no specific blogs for FAM5B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM5B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM5B