ASAP1 Antibody

Images

 
Genetic Strategies: Knockout Validated: ASAP1 Antibody [NBP2-48909] - Loss of ASAP1 results in expansion of the hypertrophic zone. E15.5 Asap1+/+ (Q,R) and Asap1GT/GT (S,T). ASAP1 immunostaining indicates ...read more
Immunocytochemistry/ Immunofluorescence: ASAP1 Antibody [NBP2-48909] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48909] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ASAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)
Publications
Read Publication using
NBP2-48909 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31246957).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASAP1 Antibody

  • 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein
  • AMAP1
  • ARF GTPase-activating protein 1
  • arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  • centaurin, beta 4
  • CENTB4
  • DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1
  • development and differentiation enhancing factor 1
  • Development and differentiation-enhancing factor 1
  • Differentiation-enhancing factor 1
  • KIAA1249DEF-1
  • PAG2
  • PAP
  • PIP2-dependent ARF1 GAP
  • ZG14P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00005324-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-44520
Species: Hu, Ca(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IF, MI
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57650
Species: Hu
Applications: WB
NBP1-79286
Species: Rt
Applications: WB
NBP2-43686
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34594
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC

Publications for ASAP1 Antibody (NBP2-48909)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ASAP1 Antibody (NBP2-48909) (0)

There are no reviews for ASAP1 Antibody (NBP2-48909). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASAP1 Antibody (NBP2-48909) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ASAP1 Products

Bioinformatics Tool for ASAP1 Antibody (NBP2-48909)

Discover related pathways, diseases and genes to ASAP1 Antibody (NBP2-48909). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAP1 Antibody (NBP2-48909)

Discover more about diseases related to ASAP1 Antibody (NBP2-48909).
 

Pathways for ASAP1 Antibody (NBP2-48909)

View related products by pathway.

PTMs for ASAP1 Antibody (NBP2-48909)

Learn more about PTMs related to ASAP1 Antibody (NBP2-48909).

Blogs on ASAP1

There are no specific blogs for ASAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAP1