P4HA2 Antibody - BSA Free

Western Blot: P4HA2 Antibody [NBP3-38083] - Western blot analysis of lysates from Rat placenta, using P4HA2 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: P4HA2 Antibody [NBP3-38083] - Immunofluorescence analysis of NIH/3T3 cells using P4HA2 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: P4HA2 Antibody [NBP3-38083] - Western blot analysis of various lysates using P4HA2 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

P4HA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit P4HA2 Antibody - BSA Free (NBP3-38083) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1).
  
  Sequence:
  SHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P4HA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for P4HA2 Antibody - BSA Free

• 2-oxoglutarate-4-dioxygenase subunit alpha-2
• 4-PH alpha 2
• 4-PH alpha-2
• alpha polypeptide II
• collagen prolyl 4-hydroxylase alpha(II)
• C-P4Halpha(II)
• EC 1.14.11.2
• Procollagen-proline
• procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase)
• prolyl 4-hydroxylase subunit alpha-2
• prolyl 4-hydroxylase, alpha polypeptide II

Background

P4HA2 encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P4HA2