Otx2 Antibody (6I3J0)

Western Blot: Otx2 Antibody (6I3J0) [NBP3-16384] - Western blot analysis of extracts of various cell lines, using Otx2 Rabbit mAb (NBP3-16384) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: Otx2 Antibody (6I3J0) [NBP3-16384] - Western blot analysis of extracts of various cell lines, using Otx2 Rabbit mAb (NBP3-16384) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 6I3J0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Otx2 Antibody (6I3J0) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 190-289 of human OTX2 (P32243). AGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: OTX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Otx2 Antibody (6I3J0)

• homeobox protein OTX2
• MCOPS5
• MGC45000
• orthodenticle homeobox 2
• orthodenticle homolog 2 (Drosophila)
• Orthodenticle homolog 2
• Otx2

Background

Homeobox protein Otx2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. It is an early marker of endodermal differentiation of embryonic stem cells and may play a role in the development of the brain and the sense organs. Two distinct isoforms have been identified. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OTX2