OSCAR Antibody - BSA Free

Staining of human cell line EFO-21 shows localization to nucleoplasm, plasma membrane & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OSCAR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OSCAR Antibody - BSA Free (NBP3-21366) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OSCAR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OSCAR Antibody - BSA Free

• hOSCAR
• MGC33613
• OSCAR
• osteoclast associated receptor OSCAR-S1
• osteoclast associated receptor OSCAR-S2
• osteoclast associated, immunoglobulin-like receptor
• osteoclast-associated immunoglobulin-like receptor
• Osteoclast-associated receptor
• PIGR3
• PIgR-3
• Poly-Ig receptor 3
• Polymeric immunoglobulin receptor 3

Background

Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex (LRC) protein family that plays critical roles in the regulation of both innate and adaptive immune responses. Different from the other LRC members, OSCAR expression is detected specifically in preosteoclasts or mature osteoclasts. OSCAR may be an important bone-specific regulator of osteoclast differentiation. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OSCAR