TDRD7 Antibody

Images

 
Immunohistochemistry: TDRD7 Antibody [NBP1-87315] - Staining of human testis shows cytoplasmic and nuclear positivity in subsets of testicular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDRD7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNADLWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEELPPPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TDRD7 Protein (NBP1-87315PEP)
Publications
Read Publication using NBP1-87315.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDRD7 Antibody

  • KIAA1529
  • PCTAIRE2-binding protein
  • PCTAIRE2BPTRAP
  • RP11-508D10.1
  • Trap
  • tudor domain containing 7
  • tudor domain-containing protein 7
  • Tudor repeat associator with PCTAIRE 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-35213
Species: Hu
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready

Publications for TDRD7 Antibody (NBP1-87315)(1)

Reviews for TDRD7 Antibody (NBP1-87315) (0)

There are no reviews for TDRD7 Antibody (NBP1-87315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TDRD7 Antibody (NBP1-87315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDRD7 Products

Bioinformatics Tool for TDRD7 Antibody (NBP1-87315)

Discover related pathways, diseases and genes to TDRD7 Antibody (NBP1-87315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD7 Antibody (NBP1-87315)

Discover more about diseases related to TDRD7 Antibody (NBP1-87315).
 

Pathways for TDRD7 Antibody (NBP1-87315)

View related products by pathway.

PTMs for TDRD7 Antibody (NBP1-87315)

Learn more about PTMs related to TDRD7 Antibody (NBP1-87315).

Blogs on TDRD7

There are no specific blogs for TDRD7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDRD7