![Immunohistochemistry: TDRD7 Antibody [NBP1-87315] - Staining of human testis shows cytoplasmic and nuclear positivity in subsets of testicular cells.](http://images.novusbio.com/fullsize2/TDRD7-Antibody-Immunohistochemistry-NBP1-87315-img0003.jpg "Immunohistochemistry: TDRD7 Antibody [NBP1-87315] - Staining of human testis shows cytoplasmic and nuclear positivity in subsets of testicular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNADLWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEELPPPV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TDRD7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Flow-Cytometry-NB100-56508-img0009.jpg){kind=icon}
-Flow-Cytometry-NB100-56508-img0010.jpg){kind=icon}
---BSA-Free-Flow-Cytometry-NB100-56508-img0011.jpg){kind=icon}
-Immunohistochemistry-Paraffin-NB100-317-img0016.jpg)
-Immunohistochemistry-Paraffin-NB100-317-img0017.jpg)
-Flow-Cytometry-NB100-317-img0018.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
-Immunocytochemistry-Immunofluorescence-NB110-3638-img0005.jpg)
-Immunohistochemistry-Paraffin-NB110-3638-img0001.jpg)
-Western-Blot-NB110-3638-img0002.jpg)
| Publication using NBP1-87315 | Applications | Species |
|---|---|---|
| Ito A, Mimae T, Yamamoto YS et al. Novel application for pseudopodia proteomics using excimer laser ablation and two-dimensional difference gel electrophoresis. Lab Invest 2012-09-01 [PMID: 22751350] |
Secondary Antibodies |
Isotype Controls |
Diseases for TDRD7 Antibody (NBP1-87315)Discover more about diseases related to TDRD7 Antibody (NBP1-87315).
| Pathways for TDRD7 Antibody (NBP1-87315)View related products by pathway.
|
PTMs for TDRD7 Antibody (NBP1-87315)Learn more about PTMs related to TDRD7 Antibody (NBP1-87315).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TDRD7 |
![Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
-Western-Blot-H00001513-M01-img0008.jpg)
-Immunocytochemistry-Immunofluorescence-H00001513-M01-img0004.jpg)
-ELISA-H00001513-M01-img0009.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_555.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_556.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_20.jpg)
![SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Knockout Validated Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Knockout_Validated_23018.jpg)
![Flow Cytometry Calcitonin R Antibody (462802) [Unconjugated]](https://images.novusbio.com/images2/Calcitonin_R_MAB4614_Flow_Cytometry_8474.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")