Cathepsin K Antibody (2F1)

Images

 
Western Blot: Cathepsin K Antibody (2F1) [H00001513-M01] - Analysis of CTSK expression in transfected 293T cell line by CTSK monoclonal antibody (M01), clone 2F1.Lane 1: CTSK transfected lysate(37 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: Cathepsin K Antibody (2F1) [H00001513-M01] - HeLa cell.
Immunohistochemistry-Paraffin: Cathepsin K Antibody (2F1) [H00001513-M01] - Analysis of monoclonal antibody to CTSK on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
ELISA: Cathepsin K Antibody (2F1) [H00001513-M01] - Detection limit for recombinant GST tagged CTSK is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin K Antibody (2F1) Summary

Immunogen
CTSK (AAH16058 220 a.a. - 329 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Specificity
CTSK (2F1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTSK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publication using H00001513-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin K Antibody (2F1)

  • cathepsin K (pycnodysostosis)
  • Cathepsin K
  • Cathepsin O
  • cathepsin O1
  • Cathepsin O2
  • Cathepsin X
  • CTS02
  • CTSK
  • CTSO
  • CTSO1
  • CTSO2
  • EC 3.4.22
  • EC 3.4.22.38
  • MGC23107
  • PKND
  • PYCD

Background

The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6449-TEC/CF
Species: Hu
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP, KO
AF1183
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready, KO
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
7270-IL/CF
Species: Hu
H00001513-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Cathepsin K Antibody (H00001513-M01)(1)

Reviews for Cathepsin K Antibody (H00001513-M01) (0)

There are no reviews for Cathepsin K Antibody (H00001513-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cathepsin K Antibody (H00001513-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cathepsin K Antibody (H00001513-M01)

Discover related pathways, diseases and genes to Cathepsin K Antibody (H00001513-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin K Antibody (H00001513-M01)

Discover more about diseases related to Cathepsin K Antibody (H00001513-M01).
 

Pathways for Cathepsin K Antibody (H00001513-M01)

View related products by pathway.

PTMs for Cathepsin K Antibody (H00001513-M01)

Learn more about PTMs related to Cathepsin K Antibody (H00001513-M01).
 

Research Areas for Cathepsin K Antibody (H00001513-M01)

Find related products by research area.

Blogs on Cathepsin K

There are no specific blogs for Cathepsin K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin K Antibody (2F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSK
Entrez
OMIM
Uniprot